BLASTX nr result
ID: Mentha24_contig00039373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00039373 (491 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26180.1| hypothetical protein MIMGU_mgv1a024509mg, partial... 49 4e-08 >gb|EYU26180.1| hypothetical protein MIMGU_mgv1a024509mg, partial [Mimulus guttatus] Length = 651 Score = 49.3 bits (116), Expect(2) = 4e-08 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +3 Query: 387 YCGDIFVRNAF-HFLVYCAELEAARAVFDESSVRDL 491 Y GD+FV N+ HFLV C ELEAA VFDES VRDL Sbjct: 150 YDGDVFVHNSLIHFLVSCRELEAANKVFDESCVRDL 185 Score = 33.5 bits (75), Expect(2) = 4e-08 Identities = 18/50 (36%), Positives = 22/50 (44%) Frame = +1 Query: 250 EAFAMHD*MLVFASSSDVSLRPGNYTXXXXXXXXXXXXXSHLGHAIIAGI 399 E F ++ ML S S V LRP NYT S LGH I+ + Sbjct: 96 EVFVLYKQMLAVVSYSGVCLRPDNYTFPLLFKTCARFSLSRLGHGILVHV 145