BLASTX nr result
ID: Mentha24_contig00039351
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00039351 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36877.1| hypothetical protein MIMGU_mgv1a013285mg [Mimulus... 87 3e-15 ref|XP_007017119.1| Fragile histidine triad isoform 2 [Theobroma... 64 2e-08 ref|XP_007017118.1| Fragile histidine triad isoform 1 [Theobroma... 64 2e-08 ref|XP_006355760.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-l... 64 3e-08 ref|XP_002326061.2| hypothetical protein POPTR_0019s15370g [Popu... 63 4e-08 gb|ABK95712.1| unknown [Populus trichocarpa] 63 4e-08 gb|EXB57582.1| Werner syndrome ATP-dependent helicase-like prote... 62 6e-08 ref|XP_006282072.1| hypothetical protein CARUB_v10028318mg [Caps... 62 1e-07 ref|XP_006489964.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-l... 61 1e-07 ref|XP_006401113.1| hypothetical protein EUTSA_v10014808mg [Eutr... 61 1e-07 ref|XP_002526385.1| histidine triad (hit) protein, putative [Ric... 61 1e-07 ref|XP_004159717.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-l... 61 2e-07 ref|XP_006421366.1| hypothetical protein CICLE_v10006852mg [Citr... 60 2e-07 gb|EPS62125.1| hypothetical protein M569_12669, partial [Genlise... 60 2e-07 ref|XP_004246259.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-l... 60 2e-07 gb|ACJ83961.1| unknown [Medicago truncatula] 60 2e-07 ref|XP_006601732.1| PREDICTED: uncharacterized protein LOC100305... 60 3e-07 gb|AAO24535.1| At5g58240 [Arabidopsis thaliana] gi|110736300|dbj... 60 3e-07 ref|NP_200632.2| protein FRAGILE HISTIDINE TRIAD [Arabidopsis th... 60 3e-07 ref|NP_974957.1| protein FRAGILE HISTIDINE TRIAD [Arabidopsis th... 60 4e-07 >gb|EYU36877.1| hypothetical protein MIMGU_mgv1a013285mg [Mimulus guttatus] Length = 225 Score = 86.7 bits (213), Expect = 3e-15 Identities = 48/94 (51%), Positives = 58/94 (61%), Gaps = 4/94 (4%) Frame = -1 Query: 271 MLKASPFLTCRY-FPTAFLFLHSSARGLFRSQYSPPLPP---FXXXXXXXXXXXSAHKME 104 MLK L+ RY F T+FL+ +S R FR ++ PPL P +ME Sbjct: 1 MLKLPALLSSRYSFTTSFLYSRTSTRRHFRRRFKPPLSPGVALPRASSFFTHNSDQAEME 60 Query: 103 SESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 SES+ FGPYKI+P EVFYSTQ SYA+VNLRPLLP Sbjct: 61 SESYAFGPYKINPSEVFYSTQLSYALVNLRPLLP 94 >ref|XP_007017119.1| Fragile histidine triad isoform 2 [Theobroma cacao] gi|508787482|gb|EOY34738.1| Fragile histidine triad isoform 2 [Theobroma cacao] Length = 195 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 112 KMESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 KM +E +TFGPYKIDPKEVFYS+ SYAMVNLRP++P Sbjct: 38 KMSTECYTFGPYKIDPKEVFYSSPLSYAMVNLRPVVP 74 >ref|XP_007017118.1| Fragile histidine triad isoform 1 [Theobroma cacao] gi|508787481|gb|EOY34737.1| Fragile histidine triad isoform 1 [Theobroma cacao] Length = 227 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -1 Query: 112 KMESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 KM +E +TFGPYKIDPKEVFYS+ SYAMVNLRP++P Sbjct: 38 KMSTECYTFGPYKIDPKEVFYSSPLSYAMVNLRPVVP 74 >ref|XP_006355760.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-like [Solanum tuberosum] Length = 195 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -1 Query: 112 KMESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 KME+ S+ FGPYKID KEVFYST SYA+VNLRPLLP Sbjct: 39 KMEATSYMFGPYKIDKKEVFYSTDFSYALVNLRPLLP 75 >ref|XP_002326061.2| hypothetical protein POPTR_0019s15370g [Populus trichocarpa] gi|550317626|gb|EEF00443.2| hypothetical protein POPTR_0019s15370g [Populus trichocarpa] Length = 153 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 SESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 +ES+ FGPYKIDPKEVFY+T SYAMVNLRPLLP Sbjct: 5 TESYQFGPYKIDPKEVFYATHLSYAMVNLRPLLP 38 >gb|ABK95712.1| unknown [Populus trichocarpa] Length = 159 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 SESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 +ES+ FGPYKIDPKEVFY+T SYAMVNLRPLLP Sbjct: 5 TESYQFGPYKIDPKEVFYATHLSYAMVNLRPLLP 38 >gb|EXB57582.1| Werner syndrome ATP-dependent helicase-like protein [Morus notabilis] Length = 536 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 109 MESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 M E++TFGPYKID KEVFYSTQ SYA VNLRPLLP Sbjct: 1 MAVENYTFGPYKIDSKEVFYSTQLSYAAVNLRPLLP 36 >ref|XP_006282072.1| hypothetical protein CARUB_v10028318mg [Capsella rubella] gi|482550776|gb|EOA14970.1| hypothetical protein CARUB_v10028318mg [Capsella rubella] Length = 193 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 97 SFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 S+TFGPYKIDP+EVFY+T SYAMVNLRPLLP Sbjct: 40 SYTFGPYKIDPREVFYATPLSYAMVNLRPLLP 71 >ref|XP_006489964.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-like [Citrus sinensis] Length = 212 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 30/39 (76%) Frame = -1 Query: 118 AHKMESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 A + FTFGPYKID KEVFYST SYAMVNLRPLLP Sbjct: 53 AQMSSTTQFTFGPYKIDAKEVFYSTPLSYAMVNLRPLLP 91 >ref|XP_006401113.1| hypothetical protein EUTSA_v10014808mg [Eutrema salsugineum] gi|557102203|gb|ESQ42566.1| hypothetical protein EUTSA_v10014808mg [Eutrema salsugineum] Length = 179 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 103 SESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 S S+ FGPYKIDP+EVFY+T SYAMVNLRPLLP Sbjct: 24 SSSYVFGPYKIDPREVFYATPFSYAMVNLRPLLP 57 >ref|XP_002526385.1| histidine triad (hit) protein, putative [Ricinus communis] gi|223534247|gb|EEF35961.1| histidine triad (hit) protein, putative [Ricinus communis] Length = 153 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -1 Query: 109 MESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 M +ES+ FGPYKIDP+EVFYST SYA+VNLRP++P Sbjct: 1 MSTESYMFGPYKIDPEEVFYSTHLSYALVNLRPVVP 36 >ref|XP_004159717.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-like [Cucumis sativus] Length = 158 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 103 SESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 S+ +TFG YKIDPKEVFYST SYAMVNLRPLLP Sbjct: 4 SDHYTFGRYKIDPKEVFYSTTLSYAMVNLRPLLP 37 >ref|XP_006421366.1| hypothetical protein CICLE_v10006852mg [Citrus clementina] gi|557523239|gb|ESR34606.1| hypothetical protein CICLE_v10006852mg [Citrus clementina] Length = 204 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = -1 Query: 94 FTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 FTFGPYKID KEVFYST SYAMVNLRPLLP Sbjct: 7 FTFGPYKIDAKEVFYSTPLSYAMVNLRPLLP 37 >gb|EPS62125.1| hypothetical protein M569_12669, partial [Genlisea aurea] Length = 173 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 112 KMESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLL 5 +M+ ESF FGPYKIDP EVFY+T SYAMVNLRP+L Sbjct: 1 QMDPESFVFGPYKIDPNEVFYTTGLSYAMVNLRPVL 36 >ref|XP_004246259.1| PREDICTED: bis(5'-adenosyl)-triphosphatase-like [Solanum lycopersicum] Length = 197 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 112 KMESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 KME+ S+ FGPYKI KEVFYST SYA+VNLRPLLP Sbjct: 40 KMETASYMFGPYKIHNKEVFYSTHFSYALVNLRPLLP 76 >gb|ACJ83961.1| unknown [Medicago truncatula] Length = 192 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 112 KMESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 KM S+ +TFGPYKI EVFYST SYAMVNLRPLLP Sbjct: 35 KMASQDYTFGPYKIHHNEVFYSTDLSYAMVNLRPLLP 71 >ref|XP_006601732.1| PREDICTED: uncharacterized protein LOC100305764 isoform X1 [Glycine max] Length = 193 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 112 KMESESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 KM +E +TFGPYKI EVFYST SYAMVNLRPLLP Sbjct: 36 KMAAEDYTFGPYKIHHTEVFYSTNLSYAMVNLRPLLP 72 >gb|AAO24535.1| At5g58240 [Arabidopsis thaliana] gi|110736300|dbj|BAF00120.1| bis(5'-adenosyl)-triphosphatase-like [Arabidopsis thaliana] Length = 180 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = -1 Query: 112 KMES--ESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 KM S S+ FGPYKIDP+EVFY+T SYAMVNLRPLLP Sbjct: 20 KMSSTCSSYAFGPYKIDPREVFYATPLSYAMVNLRPLLP 58 >ref|NP_200632.2| protein FRAGILE HISTIDINE TRIAD [Arabidopsis thaliana] gi|332009640|gb|AED97023.1| fragile histidine triad protein [Arabidopsis thaliana] Length = 180 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 2/39 (5%) Frame = -1 Query: 112 KMES--ESFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 KM S S+ FGPYKIDP+EVFY+T SYAMVNLRPLLP Sbjct: 20 KMSSTCSSYAFGPYKIDPREVFYATPLSYAMVNLRPLLP 58 >ref|NP_974957.1| protein FRAGILE HISTIDINE TRIAD [Arabidopsis thaliana] gi|8777325|dbj|BAA96915.1| bis(5'-adenosyl)-triphosphatase-like protein [Arabidopsis thaliana] gi|332009639|gb|AED97022.1| fragile histidine triad protein [Arabidopsis thaliana] Length = 160 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 97 SFTFGPYKIDPKEVFYSTQSSYAMVNLRPLLP 2 S+ FGPYKIDP+EVFY+T SYAMVNLRPLLP Sbjct: 7 SYAFGPYKIDPREVFYATPLSYAMVNLRPLLP 38