BLASTX nr result
ID: Mentha24_contig00039259
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00039259 (366 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36735.1| hypothetical protein MIMGU_mgv1a003208mg [Mimulus... 62 6e-08 gb|EPS65532.1| hypothetical protein M569_09243, partial [Genlise... 60 2e-07 >gb|EYU36735.1| hypothetical protein MIMGU_mgv1a003208mg [Mimulus guttatus] Length = 600 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = +3 Query: 3 GSSKTSTSVRNADDP-GNWACDKCTYVNSRSEAACHVCGYRR 125 GSSKTS+SVRN DD GNWACD+CTY+N+RS C +C RR Sbjct: 559 GSSKTSSSVRNTDDSSGNWACDQCTYMNARSSTTCIMCQRRR 600 >gb|EPS65532.1| hypothetical protein M569_09243, partial [Genlisea aurea] Length = 611 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/38 (65%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +3 Query: 3 GSSKTSTSVRNADDP-GNWACDKCTYVNSRSEAACHVC 113 GSS+TSTS+R+ DD GNWAC++CTYVN R+ A CH+C Sbjct: 572 GSSRTSTSIRSNDDSSGNWACERCTYVNLRTAATCHMC 609