BLASTX nr result
ID: Mentha24_contig00039198
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00039198 (408 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU21228.1| hypothetical protein MIMGU_mgv1a023092mg, partial... 66 4e-09 >gb|EYU21228.1| hypothetical protein MIMGU_mgv1a023092mg, partial [Mimulus guttatus] Length = 920 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/47 (70%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = +3 Query: 267 VDPLNGF-NATAAKADVGVILDLDTTVGKICKTCISMAIEDFYSNRN 404 V P +G NATA KADVG+ILD +T+VGKI TCISMAIEDFY+NR+ Sbjct: 3 VAPSSGLINATAVKADVGIILDFETSVGKISMTCISMAIEDFYNNRS 49