BLASTX nr result
ID: Mentha24_contig00039108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00039108 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002312219.2| hypothetical protein POPTR_0008s08040g [Popu... 56 6e-06 >ref|XP_002312219.2| hypothetical protein POPTR_0008s08040g [Populus trichocarpa] gi|550332646|gb|EEE89586.2| hypothetical protein POPTR_0008s08040g [Populus trichocarpa] Length = 2052 Score = 55.8 bits (133), Expect = 6e-06 Identities = 37/100 (37%), Positives = 54/100 (54%), Gaps = 10/100 (10%) Frame = -3 Query: 352 ADVEMTEGDDSSTGL---PSQSAENQGTVTAPTTVSVRKRL-------QEEALTSEETSS 203 +DVEM+E D S++ P+ +E Q +T + RKRL E+ L ETSS Sbjct: 1676 SDVEMSEVDGSTSVAKLTPASESETQHNITLFSQPIARKRLASSSSDLNEQPLNQGETSS 1735 Query: 202 DVPAPLPKKAKALDGLQVGADEPAAAPAKLLEVVTAEELS 83 DVP P+ K+ K D +Q G++ AA P++ L + A E S Sbjct: 1736 DVPPPVLKRPKGTDSVQEGSEGQAATPSETLVTLPAVEES 1775