BLASTX nr result
ID: Mentha24_contig00038255
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00038255 (314 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33431.1| hypothetical protein MIMGU_mgv1a019605mg, partial... 62 1e-07 >gb|EYU33431.1| hypothetical protein MIMGU_mgv1a019605mg, partial [Mimulus guttatus] Length = 244 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/45 (62%), Positives = 37/45 (82%) Frame = +3 Query: 3 NKKASPVLWEIPCGNKEHAAAVSAVTFGFAITTALLIVSTSISHS 137 +++ASPV+WEIPCG K+HA VSAVTFGFA+ + +IV TSI +S Sbjct: 189 DREASPVMWEIPCGIKKHAEFVSAVTFGFAVLASSIIVLTSIFYS 233