BLASTX nr result
ID: Mentha24_contig00038019
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00038019 (484 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34297.1| hypothetical protein MIMGU_mgv1a014245mg [Mimulus... 55 8e-06 >gb|EYU34297.1| hypothetical protein MIMGU_mgv1a014245mg [Mimulus guttatus] Length = 196 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = -2 Query: 360 VVPKSCWSRRRALQRIVPGGEGLDGVSLLRETLDYIVALRAQVDVM 223 + K R R L+R+VPGGE +D VSL++ETLDYI +L+ QVDVM Sbjct: 133 IAKKMVKKRTRVLKRLVPGGEQMDEVSLIKETLDYIASLQVQVDVM 178