BLASTX nr result
ID: Mentha24_contig00037719
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00037719 (399 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36825.1| hypothetical protein MIMGU_mgv1a013119mg [Mimulus... 58 2e-06 >gb|EYU36825.1| hypothetical protein MIMGU_mgv1a013119mg [Mimulus guttatus] Length = 230 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +1 Query: 4 KPDSGRRDP-IFRIKLTRMDSLSFWEKCHVSDIRTMMKRLE 123 KPD GR++ +FR+KLTR+DSL FWEKC SD+R+ KRLE Sbjct: 160 KPDLGRKEQHVFRLKLTRVDSLGFWEKCGASDVRSAAKRLE 200