BLASTX nr result
ID: Mentha24_contig00037588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00037588 (338 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS60204.1| ferrochelatase, partial [Genlisea aurea] 61 1e-07 gb|EYU29313.1| hypothetical protein MIMGU_mgv1a005803mg [Mimulus... 60 2e-07 ref|XP_002309511.2| hypothetical protein POPTR_0006s24820g [Popu... 59 5e-07 ref|XP_002516467.1| ferrochelatase, putative [Ricinus communis] ... 58 1e-06 ref|XP_006287655.1| hypothetical protein CARUB_v10000866mg [Caps... 56 6e-06 ref|XP_006371877.1| hypothetical protein POPTR_0018s04980g [Popu... 55 8e-06 >gb|EPS60204.1| ferrochelatase, partial [Genlisea aurea] Length = 238 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/55 (52%), Positives = 40/55 (72%) Frame = +3 Query: 3 PSAMPISNSNSNATTSHKSENDIVAYAIKMIFGSIFAFFLLLSPKVVSAFRNHVL 167 PSA+ + + + + ++D V+YA+KMIFGSI AF L+LSPK +SAFRNHVL Sbjct: 184 PSAVGMPAAAAAGRNDDEDDDDAVSYAVKMIFGSILAFLLVLSPKAMSAFRNHVL 238 >gb|EYU29313.1| hypothetical protein MIMGU_mgv1a005803mg [Mimulus guttatus] Length = 470 Score = 60.5 bits (145), Expect = 2e-07 Identities = 30/55 (54%), Positives = 41/55 (74%) Frame = +3 Query: 3 PSAMPISNSNSNATTSHKSENDIVAYAIKMIFGSIFAFFLLLSPKVVSAFRNHVL 167 PSA+ ISN S+ TTS +++ND++ Y +K+ FGSI AFFLLLS K SA R +V+ Sbjct: 417 PSALAISNP-SDTTTSEETDNDLLGYVVKIFFGSIVAFFLLLSLKAASALRKYVI 470 >ref|XP_002309511.2| hypothetical protein POPTR_0006s24820g [Populus trichocarpa] gi|550337031|gb|EEE93034.2| hypothetical protein POPTR_0006s24820g [Populus trichocarpa] Length = 491 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/52 (57%), Positives = 38/52 (73%) Frame = +3 Query: 3 PSAMPISNSNSNATTSHKSENDIVAYAIKMIFGSIFAFFLLLSPKVVSAFRN 158 PSA S + S TS +S+ D ++YAIKMIFGS+ AF LL SPKV++AFRN Sbjct: 440 PSAKSFSTTRS---TSEESDRDFLSYAIKMIFGSVLAFVLLFSPKVITAFRN 488 >ref|XP_002516467.1| ferrochelatase, putative [Ricinus communis] gi|223544287|gb|EEF45808.1| ferrochelatase, putative [Ricinus communis] Length = 480 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/55 (58%), Positives = 39/55 (70%) Frame = +3 Query: 3 PSAMPISNSNSNATTSHKSENDIVAYAIKMIFGSIFAFFLLLSPKVVSAFRNHVL 167 PSA IS S S TS +++ D YAIK+ FGSI AF LLLSPK++ AFRN+VL Sbjct: 429 PSAKAISTSKS---TSEEADYDPFRYAIKLFFGSILAFILLLSPKMIFAFRNNVL 480 >ref|XP_006287655.1| hypothetical protein CARUB_v10000866mg [Capsella rubella] gi|482556361|gb|EOA20553.1| hypothetical protein CARUB_v10000866mg [Capsella rubella] Length = 476 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = +3 Query: 27 SNSNATTSHKSEN-DIVAYAIKMIFGSIFAFFLLLSPKVVSAFRNHVL 167 SN NA S SE+ D +Y +KM FGSI AF LLLSPK+ AFRNH++ Sbjct: 429 SNPNAVVSEDSESSDAFSYIVKMFFGSILAFALLLSPKMFHAFRNHII 476 >ref|XP_006371877.1| hypothetical protein POPTR_0018s04980g [Populus trichocarpa] gi|550318071|gb|ERP49674.1| hypothetical protein POPTR_0018s04980g [Populus trichocarpa] Length = 292 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/54 (53%), Positives = 37/54 (68%) Frame = +3 Query: 3 PSAMPISNSNSNATTSHKSENDIVAYAIKMIFGSIFAFFLLLSPKVVSAFRNHV 164 PSA IS + TS ++++D V+YA KMIFG AF +LLSPKV AFRNH+ Sbjct: 241 PSAKAISTTRR---TSEEADHDFVSYATKMIFGPFLAFVMLLSPKVSLAFRNHL 291