BLASTX nr result
ID: Mentha24_contig00037557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00037557 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing... 60 3e-07 ref|XP_006439990.1| hypothetical protein CICLE_v10020762mg [Citr... 57 2e-06 gb|EYU22242.1| hypothetical protein MIMGU_mgv1a009133mg [Mimulus... 56 5e-06 ref|XP_007209189.1| hypothetical protein PRUPE_ppa006416mg [Prun... 55 8e-06 >ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Citrus sinensis] Length = 363 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 101 RQFKLKAQQDKRGNDARWRLLVKKVVSARTISS 3 RQFKLKAQQ+K+G+D RWRLLVKKVVSA+TISS Sbjct: 305 RQFKLKAQQEKKGDDGRWRLLVKKVVSAKTISS 337 >ref|XP_006439990.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] gi|557542252|gb|ESR53230.1| hypothetical protein CICLE_v10020762mg [Citrus clementina] Length = 363 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -2 Query: 101 RQFKLKAQQDKRGNDARWRLLVKKVVSARTISS 3 RQFKLKAQ +K+G+D RWRLLVKKVVSA+TISS Sbjct: 305 RQFKLKAQLEKKGDDGRWRLLVKKVVSAKTISS 337 >gb|EYU22242.1| hypothetical protein MIMGU_mgv1a009133mg [Mimulus guttatus] Length = 352 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -2 Query: 101 RQFKLKAQQDKRGNDARWRLLVKKVVSARTISS 3 RQFKLKAQQ++RGND RW+LLV+KVVSA+ +SS Sbjct: 301 RQFKLKAQQNRRGNDTRWKLLVRKVVSAKAMSS 333 >ref|XP_007209189.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] gi|462404924|gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] Length = 413 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 101 RQFKLKAQQDKRGNDARWRLLVKKVVSARTISS 3 RQFKLK QQ+K+ +DARW+LLV+KVVSARTISS Sbjct: 355 RQFKLKMQQEKKKDDARWKLLVRKVVSARTISS 387