BLASTX nr result
ID: Mentha24_contig00037542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00037542 (802 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26793.1| hypothetical protein MIMGU_mgv1a0006321mg, partia... 61 5e-07 >gb|EYU26793.1| hypothetical protein MIMGU_mgv1a0006321mg, partial [Mimulus guttatus] Length = 821 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -1 Query: 688 CIPEEGNYCSAIYSTLSSPVSALKFATSGVRFVAGFDYGQV 566 C+PEE N+CSAI+S +SPV AL+FATSGVR V GF GQV Sbjct: 555 CLPEERNHCSAIFSISTSPVCALQFATSGVRLVVGFQSGQV 595