BLASTX nr result
ID: Mentha24_contig00036955
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036955 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006478907.1| PREDICTED: exportin-1-like [Citrus sinensis] 75 9e-12 ref|XP_006443178.1| hypothetical protein CICLE_v100187642mg, par... 75 9e-12 ref|XP_006400241.1| hypothetical protein EUTSA_v10012517mg [Eutr... 75 9e-12 ref|XP_006286949.1| hypothetical protein CARUB_v10000095mg [Caps... 75 9e-12 ref|XP_007220912.1| hypothetical protein PRUPE_ppa000601mg [Prun... 75 9e-12 ref|NP_197204.1| exportin 1A [Arabidopsis thaliana] gi|5931694|e... 75 9e-12 ref|NP_001190324.1| exportin 1A [Arabidopsis thaliana] gi|332004... 75 9e-12 ref|XP_002871746.1| hypothetical protein ARALYDRAFT_909689 [Arab... 75 9e-12 ref|XP_002461885.1| hypothetical protein SORBIDRAFT_02g009800 [S... 74 2e-11 gb|EYU19736.1| hypothetical protein MIMGU_mgv1a000560mg [Mimulus... 74 2e-11 gb|EXB29171.1| hypothetical protein L484_019696 [Morus notabilis] 74 2e-11 ref|XP_002319892.2| exportin1 family protein [Populus trichocarp... 74 2e-11 ref|XP_002325460.2| exportin1 family protein [Populus trichocarp... 74 2e-11 ref|XP_007029549.1| Exportin 1A isoform 1 [Theobroma cacao] gi|5... 74 2e-11 ref|XP_004137175.1| PREDICTED: exportin-1-like [Cucumis sativus]... 74 2e-11 ref|XP_003633992.1| PREDICTED: exportin-1 isoform 3 [Vitis vinif... 74 2e-11 ref|XP_003633991.1| PREDICTED: exportin-1 isoform 2 [Vitis vinif... 74 2e-11 ref|XP_002520018.1| chromosome region maintenance protein 1/expo... 74 2e-11 ref|XP_002275630.1| PREDICTED: exportin-1 isoform 1 [Vitis vinif... 74 2e-11 gb|EYU45370.1| hypothetical protein MIMGU_mgv1a000558mg [Mimulus... 73 4e-11 >ref|XP_006478907.1| PREDICTED: exportin-1-like [Citrus sinensis] Length = 1076 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEMVDS Sbjct: 1024 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMVDS 1076 >ref|XP_006443178.1| hypothetical protein CICLE_v100187642mg, partial [Citrus clementina] gi|557545440|gb|ESR56418.1| hypothetical protein CICLE_v100187642mg, partial [Citrus clementina] Length = 754 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEMVDS Sbjct: 702 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMVDS 754 >ref|XP_006400241.1| hypothetical protein EUTSA_v10012517mg [Eutrema salsugineum] gi|557101331|gb|ESQ41694.1| hypothetical protein EUTSA_v10012517mg [Eutrema salsugineum] Length = 1076 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEMVDS Sbjct: 1024 RDFLVQSKEFSAQDNKDLYAEEAAAQREQERQRMLSIPGLIAPNEIQDEMVDS 1076 >ref|XP_006286949.1| hypothetical protein CARUB_v10000095mg [Capsella rubella] gi|482555655|gb|EOA19847.1| hypothetical protein CARUB_v10000095mg [Capsella rubella] Length = 1075 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEMVDS Sbjct: 1023 RDFLVQSKEFSAQDNKDLYAEEAALQRERERQRMLSIPGLIAPNEIQDEMVDS 1075 >ref|XP_007220912.1| hypothetical protein PRUPE_ppa000601mg [Prunus persica] gi|462417374|gb|EMJ22111.1| hypothetical protein PRUPE_ppa000601mg [Prunus persica] Length = 1077 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEMVDS Sbjct: 1025 RDFLVQSKEFSAQDNKDLYAEEAAAQREKDRQRMLSIPGLIAPNEIQDEMVDS 1077 >ref|NP_197204.1| exportin 1A [Arabidopsis thaliana] gi|5931694|emb|CAB56597.1| Exportin1 (XPO1) protein [Arabidopsis thaliana] gi|7671510|emb|CAB89280.1| Exportin1 (XPO1) protein [Arabidopsis thaliana] gi|9755703|emb|CAC01715.1| Exportin1 (XPO1) protein [Arabidopsis thaliana] gi|15810123|gb|AAL07205.1| putative exportin1 protein XPO1 [Arabidopsis thaliana] gi|20465601|gb|AAM20283.1| putative Exportin1 (XPO1) protein [Arabidopsis thaliana] gi|332004990|gb|AED92373.1| exportin 1A [Arabidopsis thaliana] Length = 1075 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEMVDS Sbjct: 1023 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMVDS 1075 >ref|NP_001190324.1| exportin 1A [Arabidopsis thaliana] gi|332004991|gb|AED92374.1| exportin 1A [Arabidopsis thaliana] Length = 1060 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEMVDS Sbjct: 1008 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMVDS 1060 >ref|XP_002871746.1| hypothetical protein ARALYDRAFT_909689 [Arabidopsis lyrata subsp. lyrata] gi|297317583|gb|EFH48005.1| hypothetical protein ARALYDRAFT_909689 [Arabidopsis lyrata subsp. lyrata] Length = 1076 Score = 75.1 bits (183), Expect = 9e-12 Identities = 40/53 (75%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEMVDS Sbjct: 1024 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMVDS 1076 >ref|XP_002461885.1| hypothetical protein SORBIDRAFT_02g009800 [Sorghum bicolor] gi|241925262|gb|EER98406.1| hypothetical protein SORBIDRAFT_02g009800 [Sorghum bicolor] Length = 1072 Score = 74.3 bits (181), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNE+QDEMVDS Sbjct: 1020 RDFLVQSKEFSAQDNKDLYAEEAAAQREKERQRMLSIPGLIAPNELQDEMVDS 1072 >gb|EYU19736.1| hypothetical protein MIMGU_mgv1a000560mg [Mimulus guttatus] Length = 1076 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEM+DS Sbjct: 1024 RDFLVQSKEFSAQDNKDLYADEAAVQREKERQRMLSIPGLIAPNEIQDEMLDS 1076 >gb|EXB29171.1| hypothetical protein L484_019696 [Morus notabilis] Length = 1121 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEM+DS Sbjct: 1069 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMLDS 1121 >ref|XP_002319892.2| exportin1 family protein [Populus trichocarpa] gi|550325378|gb|EEE95815.2| exportin1 family protein [Populus trichocarpa] Length = 1040 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEM+DS Sbjct: 988 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMLDS 1040 >ref|XP_002325460.2| exportin1 family protein [Populus trichocarpa] gi|550316982|gb|EEE99841.2| exportin1 family protein [Populus trichocarpa] Length = 1081 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEM+DS Sbjct: 1029 RDFLVQSKEFSAQDNKDLYAEEAAVQRERERQRMLSIPGLIAPNEIQDEMLDS 1081 >ref|XP_007029549.1| Exportin 1A isoform 1 [Theobroma cacao] gi|590639005|ref|XP_007029550.1| Exportin 1A isoform 1 [Theobroma cacao] gi|508718154|gb|EOY10051.1| Exportin 1A isoform 1 [Theobroma cacao] gi|508718155|gb|EOY10052.1| Exportin 1A isoform 1 [Theobroma cacao] Length = 1076 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEM+DS Sbjct: 1024 RDFLVQSKEFSAQDNKDLYAEEAAVQRERERQRMLSIPGLIAPNEIQDEMLDS 1076 >ref|XP_004137175.1| PREDICTED: exportin-1-like [Cucumis sativus] gi|449476468|ref|XP_004154745.1| PREDICTED: exportin-1-like [Cucumis sativus] Length = 1076 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q ML+IPGLIAPNEIQDEMVDS Sbjct: 1024 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLTIPGLIAPNEIQDEMVDS 1076 >ref|XP_003633992.1| PREDICTED: exportin-1 isoform 3 [Vitis vinifera] Length = 1069 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEM+DS Sbjct: 1017 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMLDS 1069 >ref|XP_003633991.1| PREDICTED: exportin-1 isoform 2 [Vitis vinifera] Length = 1061 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEM+DS Sbjct: 1009 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMLDS 1061 >ref|XP_002520018.1| chromosome region maintenance protein 1/exportin, putative [Ricinus communis] gi|223540782|gb|EEF42342.1| chromosome region maintenance protein 1/exportin, putative [Ricinus communis] Length = 1069 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEM+DS Sbjct: 1017 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMLDS 1069 >ref|XP_002275630.1| PREDICTED: exportin-1 isoform 1 [Vitis vinifera] gi|147799770|emb|CAN61845.1| hypothetical protein VITISV_008353 [Vitis vinifera] gi|297737334|emb|CBI26535.3| unnamed protein product [Vitis vinifera] Length = 1076 Score = 73.9 bits (180), Expect = 2e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAPNEIQDEM+DS Sbjct: 1024 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPNEIQDEMLDS 1076 >gb|EYU45370.1| hypothetical protein MIMGU_mgv1a000558mg [Mimulus guttatus] Length = 1076 Score = 73.2 bits (178), Expect = 4e-11 Identities = 39/53 (73%), Positives = 40/53 (75%) Frame = -1 Query: 472 RDFLVQSKEFSAQDNKDLYXXXXXXXXXXXXQHMLSIPGLIAPNEIQDEMVDS 314 RDFLVQSKEFSAQDNKDLY Q MLSIPGLIAP+EIQDEMVDS Sbjct: 1024 RDFLVQSKEFSAQDNKDLYAEEAAAQRERERQRMLSIPGLIAPSEIQDEMVDS 1076