BLASTX nr result
ID: Mentha24_contig00036868
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036868 (472 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512053.1| conserved hypothetical protein [Ricinus comm... 56 5e-06 >ref|XP_002512053.1| conserved hypothetical protein [Ricinus communis] gi|223549233|gb|EEF50722.1| conserved hypothetical protein [Ricinus communis] Length = 324 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 14/72 (19%) Frame = +3 Query: 150 SSGFKTPPPYAITPMKSYKELTRFADHSS-ISLP-------------KICEERNGADCPW 287 SSGF+TPPPYA TP KSYK+L ++DH ISL ++ +E+ D W Sbjct: 169 SSGFRTPPPYANTPTKSYKDLRSYSDHKQVISLSMQNGNVKSTGLQNEVLDEKKKTDLSW 228 Query: 288 IEEKRRVSEKIN 323 ++EK ++S+ ++ Sbjct: 229 LDEKFKISDALS 240