BLASTX nr result
ID: Mentha24_contig00036825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036825 (388 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38031.1| hypothetical protein MIMGU_mgv1a010394mg [Mimulus... 94 2e-17 >gb|EYU38031.1| hypothetical protein MIMGU_mgv1a010394mg [Mimulus guttatus] Length = 313 Score = 94.0 bits (232), Expect = 2e-17 Identities = 50/78 (64%), Positives = 57/78 (73%) Frame = -2 Query: 234 MVQQTKDSTFTEYRLAHAESGLSNSDKQLSISIASKRTELLGPHNESPMAVSKSIGSQFP 55 MVQQTKDSTFTEY LAH +SGLSNSDKQLS + +K +EL NE+PM VSKSIGS Sbjct: 1 MVQQTKDSTFTEYGLAHVQSGLSNSDKQLSEFVPAKTSELQSSCNENPMTVSKSIGSPLL 60 Query: 54 VETSENVDAAAKISGTKR 1 +E SE K+SGTKR Sbjct: 61 MEDSECAGEVVKMSGTKR 78