BLASTX nr result
ID: Mentha24_contig00036702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036702 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43671.1| hypothetical protein MIMGU_mgv1a000234mg [Mimulus... 70 3e-10 >gb|EYU43671.1| hypothetical protein MIMGU_mgv1a000234mg [Mimulus guttatus] Length = 1390 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = +2 Query: 254 MAKSRPHFPAQDVLSSAQGSVRSREWEGPTRWTEY 358 MAKSR HFP QDVLSSAQ +VRSREWEGPTRWTEY Sbjct: 1 MAKSRSHFPTQDVLSSAQAAVRSREWEGPTRWTEY 35