BLASTX nr result
ID: Mentha24_contig00036639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036639 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39296.1| hypothetical protein MIMGU_mgv1a015360mg [Mimulus... 89 6e-16 >gb|EYU39296.1| hypothetical protein MIMGU_mgv1a015360mg [Mimulus guttatus] Length = 160 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/58 (72%), Positives = 48/58 (82%) Frame = +1 Query: 142 VLLFGVLAPEVGFEDLHNADELLHLIEAAAQLGFPRPGSLQPRLRLREPIPQILHHHR 315 V L APEVGFE LH+ADEL HL++A AQLGFPRPGSL+PRLRL EP+ QILHH+R Sbjct: 50 VSLIAESAPEVGFEYLHHADELFHLLQAEAQLGFPRPGSLEPRLRLGEPLSQILHHYR 107