BLASTX nr result
ID: Mentha24_contig00036596
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036596 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC33378.1| hypothetical protein L484_010788 [Morus notabilis] 65 1e-08 ref|XP_006447039.1| hypothetical protein CICLE_v10017602mg [Citr... 58 2e-06 ref|XP_007031910.1| Uncharacterized protein TCM_017241 [Theobrom... 57 2e-06 ref|XP_002270801.2| PREDICTED: uncharacterized protein LOC100243... 57 3e-06 >gb|EXC33378.1| hypothetical protein L484_010788 [Morus notabilis] Length = 146 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/58 (53%), Positives = 40/58 (68%) Frame = +3 Query: 36 AFGVLFVGISFALMLFGLVTLIVGIILMPLVISLIFSFYFFETASNFSKISRAIFWPA 209 AF LF+GIS ALMLFG VT +G +LMPLV+ L+ FY E N S++ R+I +PA Sbjct: 55 AFASLFLGISLALMLFGSVTFAIGFVLMPLVMGLVLLFYALEILFNLSELGRSILFPA 112 >ref|XP_006447039.1| hypothetical protein CICLE_v10017602mg [Citrus clementina] gi|568831675|ref|XP_006470086.1| PREDICTED: uncharacterized protein LOC102614893 [Citrus sinensis] gi|557549650|gb|ESR60279.1| hypothetical protein CICLE_v10017602mg [Citrus clementina] Length = 134 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/65 (43%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Frame = +3 Query: 33 AAFGVLFVGISFALMLFGLVTLIVGIILMPLVISLIFSFYFFETASNFSKISRAIFWPAP 212 AAF LF+G+S ALMLFG +T ++G ILMP +++ +F FY S S + ++ F Sbjct: 58 AAFASLFLGVSLALMLFGSITFVIGFILMPWIVAFVFLFYLAGFFSKLSDLGQSFFCSGD 117 Query: 213 -HSCN 224 SCN Sbjct: 118 VPSCN 122 >ref|XP_007031910.1| Uncharacterized protein TCM_017241 [Theobroma cacao] gi|508710939|gb|EOY02836.1| Uncharacterized protein TCM_017241 [Theobroma cacao] Length = 124 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/54 (51%), Positives = 37/54 (68%) Frame = +3 Query: 33 AAFGVLFVGISFALMLFGLVTLIVGIILMPLVISLIFSFYFFETASNFSKISRA 194 AAF LF+GIS ALML G VT I+G ++MP VI L+ F+F S FS++ R+ Sbjct: 58 AAFATLFLGISLALMLVGSVTFIIGFVIMPWVICLLAVFHFVAVVSTFSELWRS 111 >ref|XP_002270801.2| PREDICTED: uncharacterized protein LOC100243721 [Vitis vinifera] Length = 127 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/59 (50%), Positives = 35/59 (59%) Frame = +3 Query: 33 AAFGVLFVGISFALMLFGLVTLIVGIILMPLVISLIFSFYFFETASNFSKISRAIFWPA 209 A F L +GIS ALML G VT +G ILMP V+ L+ FYF SN S + RAI A Sbjct: 53 AGFASLLLGISLALMLCGSVTFFIGFILMPWVLGLVMVFYFVGIVSNLSVLGRAIICQA 111