BLASTX nr result
ID: Mentha24_contig00036451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036451 (406 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007222168.1| hypothetical protein PRUPE_ppa005814mg [Prun... 56 5e-06 ref|XP_004141383.1| PREDICTED: WD repeat-containing protein 18-l... 56 6e-06 >ref|XP_007222168.1| hypothetical protein PRUPE_ppa005814mg [Prunus persica] gi|462419104|gb|EMJ23367.1| hypothetical protein PRUPE_ppa005814mg [Prunus persica] Length = 442 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/33 (69%), Positives = 29/33 (87%) Frame = +2 Query: 2 RLKNDQQCSLQMIQHWKTMYDNLHQFCVDELLE 100 RLK+D + S+QM+Q WK MYDNLHQFCV+ELL+ Sbjct: 398 RLKHDYERSIQMVQQWKKMYDNLHQFCVNELLD 430 >ref|XP_004141383.1| PREDICTED: WD repeat-containing protein 18-like [Cucumis sativus] gi|449531442|ref|XP_004172695.1| PREDICTED: WD repeat-containing protein 18-like [Cucumis sativus] Length = 451 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = +2 Query: 2 RLKNDQQCSLQMIQHWKTMYDNLHQFCVDELLEDVRTE 115 RLK+D S QM+QHW+ MYDNLHQFCV+ELL+ +T+ Sbjct: 407 RLKHDYGKSKQMLQHWRKMYDNLHQFCVNELLDGNQTK 444