BLASTX nr result
ID: Mentha24_contig00036256
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036256 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004237583.1| PREDICTED: F-box protein PP2-B11-like [Solan... 57 2e-06 ref|XP_004253171.1| PREDICTED: F-box protein PP2-B10-like [Solan... 56 6e-06 >ref|XP_004237583.1| PREDICTED: F-box protein PP2-B11-like [Solanum lycopersicum] Length = 256 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +2 Query: 2 MVGARELGIIWCGDTPQYWDYASHPDSRFSEVALLKS 112 M+ AR+LGIIW G TP YW++ SHPD+RFSEVA LKS Sbjct: 98 MIAARKLGIIW-GGTPAYWEWLSHPDARFSEVAKLKS 133 >ref|XP_004253171.1| PREDICTED: F-box protein PP2-B10-like [Solanum lycopersicum] Length = 272 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = +2 Query: 2 MVGARELGIIWCGDTPQYWDYASHPDSRFSEVALLK 109 M+ AREL I W DTP YW++ SHPDSRFSEVA LK Sbjct: 101 MISARELAISWGVDTPWYWEWISHPDSRFSEVAHLK 136