BLASTX nr result
ID: Mentha24_contig00036017
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036017 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31591.1| hypothetical protein MIMGU_mgv1a011799mg [Mimulus... 57 3e-06 >gb|EYU31591.1| hypothetical protein MIMGU_mgv1a011799mg [Mimulus guttatus] Length = 270 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = +3 Query: 156 MASFAVPCPKVSPPLAASSQPCQKSHHIASFPRSECRLVPPSM-LAKIKGLSRSQ 317 MASF+VPCPKVSP L+ASS QK + IASFP S+ R SM + + +GL RSQ Sbjct: 1 MASFSVPCPKVSPLLSASSHSTQKRNRIASFPTSDSRSNYASMAVVQSQGLGRSQ 55