BLASTX nr result
ID: Mentha24_contig00036008
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00036008 (708 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004231862.1| PREDICTED: CBS domain-containing protein CBS... 64 1e-11 ref|XP_004231863.1| PREDICTED: CBS domain-containing protein CBS... 64 1e-11 gb|EYU44424.1| hypothetical protein MIMGU_mgv1a012997mg [Mimulus... 69 1e-11 ref|XP_006339869.1| PREDICTED: CBS domain-containing protein CBS... 64 1e-11 ref|XP_006494468.1| PREDICTED: CBS domain-containing protein CBS... 66 1e-11 ref|XP_006425954.1| hypothetical protein CICLE_v10026357mg [Citr... 66 1e-11 ref|XP_006425955.1| hypothetical protein CICLE_v10026357mg [Citr... 66 1e-11 ref|XP_006425952.1| hypothetical protein CICLE_v10026357mg [Citr... 66 1e-11 ref|XP_004288013.1| PREDICTED: CBS domain-containing protein CBS... 69 2e-11 emb|CAN64036.1| hypothetical protein VITISV_021555 [Vitis vinifera] 66 5e-11 ref|XP_002283079.1| PREDICTED: CBS domain-containing protein CBS... 66 5e-11 emb|CBI21385.3| unnamed protein product [Vitis vinifera] 66 5e-11 emb|CBY11152.1| unnamed protein product [Oikopleura dioica] 66 6e-11 ref|XP_007047342.1| Cystathionine beta-synthase family protein i... 66 7e-11 ref|XP_007047345.1| Cystathionine beta-synthase family protein i... 66 7e-11 ref|XP_007042479.1| Cystathionine beta-synthase family protein [... 65 9e-11 ref|XP_007206104.1| hypothetical protein PRUPE_ppa012987mg [Prun... 67 2e-10 ref|XP_004304019.1| PREDICTED: CBS domain-containing protein CBS... 65 2e-10 dbj|BAJ53196.1| JHL03K20.5 [Jatropha curcas] 66 3e-10 ref|XP_002534340.1| conserved hypothetical protein [Ricinus comm... 66 4e-10 >ref|XP_004231862.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform 1 [Solanum lycopersicum] Length = 251 Score = 64.3 bits (155), Expect(2) = 1e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAP+VV ESTNLEDAAR+LL+TKYRRLPV+D Sbjct: 187 GDLMTPAPLVVRESTNLEDAARLLLKTKYRRLPVVD 222 Score = 32.0 bits (71), Expect(2) = 1e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 127 GNVVRAALQIKRATKM 174 GNVVRAALQIKRAT+M Sbjct: 234 GNVVRAALQIKRATEM 249 >ref|XP_004231863.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like isoform 2 [Solanum lycopersicum] Length = 234 Score = 64.3 bits (155), Expect(2) = 1e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAP+VV ESTNLEDAAR+LL+TKYRRLPV+D Sbjct: 170 GDLMTPAPLVVRESTNLEDAARLLLKTKYRRLPVVD 205 Score = 32.0 bits (71), Expect(2) = 1e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 127 GNVVRAALQIKRATKM 174 GNVVRAALQIKRAT+M Sbjct: 217 GNVVRAALQIKRATEM 232 >gb|EYU44424.1| hypothetical protein MIMGU_mgv1a012997mg [Mimulus guttatus] Length = 233 Score = 69.3 bits (168), Expect(2) = 1e-11 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLDD 112 GD+MTPAPVVV ESTNLEDAAR+LLETKYRRLPV+DD Sbjct: 170 GDLMTPAPVVVRESTNLEDAARLLLETKYRRLPVVDD 206 Score = 26.9 bits (58), Expect(2) = 1e-11 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = +1 Query: 127 GNVVRAALQIKRATKMA 177 GNVVRAALQIKR + A Sbjct: 217 GNVVRAALQIKRDVESA 233 >ref|XP_006339869.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Solanum tuberosum] Length = 232 Score = 64.3 bits (155), Expect(2) = 1e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAP+VV ESTNLEDAAR+LL+TKYRRLPV+D Sbjct: 168 GDLMTPAPLVVRESTNLEDAARLLLKTKYRRLPVVD 203 Score = 32.0 bits (71), Expect(2) = 1e-11 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 127 GNVVRAALQIKRATKM 174 GNVVRAALQIKRAT+M Sbjct: 215 GNVVRAALQIKRATEM 230 >ref|XP_006494468.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Citrus sinensis] Length = 245 Score = 65.9 bits (159), Expect(2) = 1e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 180 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 215 Score = 30.0 bits (66), Expect(2) = 1e-11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 127 GNVVRAALQIKRATKM 174 GNVVRAALQIK AT+M Sbjct: 227 GNVVRAALQIKHATEM 242 >ref|XP_006425954.1| hypothetical protein CICLE_v10026357mg [Citrus clementina] gi|557527944|gb|ESR39194.1| hypothetical protein CICLE_v10026357mg [Citrus clementina] Length = 245 Score = 65.9 bits (159), Expect(2) = 1e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 180 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 215 Score = 30.0 bits (66), Expect(2) = 1e-11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 127 GNVVRAALQIKRATKM 174 GNVVRAALQIK AT+M Sbjct: 227 GNVVRAALQIKHATEM 242 >ref|XP_006425955.1| hypothetical protein CICLE_v10026357mg [Citrus clementina] gi|557527945|gb|ESR39195.1| hypothetical protein CICLE_v10026357mg [Citrus clementina] Length = 189 Score = 65.9 bits (159), Expect(2) = 1e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 124 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 159 Score = 30.0 bits (66), Expect(2) = 1e-11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 127 GNVVRAALQIKRATKM 174 GNVVRAALQIK AT+M Sbjct: 171 GNVVRAALQIKHATEM 186 >ref|XP_006425952.1| hypothetical protein CICLE_v10026357mg [Citrus clementina] gi|557527942|gb|ESR39192.1| hypothetical protein CICLE_v10026357mg [Citrus clementina] Length = 156 Score = 65.9 bits (159), Expect(2) = 1e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 91 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 126 Score = 30.0 bits (66), Expect(2) = 1e-11 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +1 Query: 127 GNVVRAALQIKRATKM 174 GNVVRAALQIK AT+M Sbjct: 138 GNVVRAALQIKHATEM 153 >ref|XP_004288013.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 235 Score = 68.6 bits (166), Expect(2) = 2e-11 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLDD 112 GDVMTPAPVVV E+TNLED AR+LLETKYRRLPV+DD Sbjct: 171 GDVMTPAPVVVRETTNLEDVARILLETKYRRLPVVDD 207 Score = 26.6 bits (57), Expect(2) = 2e-11 Identities = 10/16 (62%), Positives = 15/16 (93%) Frame = +1 Query: 127 GNVVRAALQIKRATKM 174 GN++RAALQ+K A++M Sbjct: 218 GNIIRAALQMKHASEM 233 >emb|CAN64036.1| hypothetical protein VITISV_021555 [Vitis vinifera] Length = 288 Score = 65.9 bits (159), Expect(2) = 5e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 225 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 260 Score = 28.1 bits (61), Expect(2) = 5e-11 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 127 GNVVRAALQIKRATK 171 GNVVRAALQIKRA + Sbjct: 272 GNVVRAALQIKRAVE 286 >ref|XP_002283079.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Vitis vinifera] Length = 246 Score = 65.9 bits (159), Expect(2) = 5e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 183 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 218 Score = 28.1 bits (61), Expect(2) = 5e-11 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 127 GNVVRAALQIKRATK 171 GNVVRAALQIKRA + Sbjct: 230 GNVVRAALQIKRAVE 244 >emb|CBI21385.3| unnamed protein product [Vitis vinifera] Length = 172 Score = 65.9 bits (159), Expect(2) = 5e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 109 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 144 Score = 28.1 bits (61), Expect(2) = 5e-11 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = +1 Query: 127 GNVVRAALQIKRATK 171 GNVVRAALQIKRA + Sbjct: 156 GNVVRAALQIKRAVE 170 >emb|CBY11152.1| unnamed protein product [Oikopleura dioica] Length = 158 Score = 65.9 bits (159), Expect(2) = 6e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 93 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 128 Score = 28.1 bits (61), Expect(2) = 6e-11 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = +1 Query: 127 GNVVRAALQIKRATKM 174 GNVVRAAL IK AT+M Sbjct: 140 GNVVRAALSIKHATEM 155 >ref|XP_007047342.1| Cystathionine beta-synthase family protein isoform 1 [Theobroma cacao] gi|508699603|gb|EOX91499.1| Cystathionine beta-synthase family protein isoform 1 [Theobroma cacao] Length = 241 Score = 65.9 bits (159), Expect(2) = 7e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 177 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 212 Score = 27.7 bits (60), Expect(2) = 7e-11 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 127 GNVVRAALQIKRA 165 GNVVRAALQIKRA Sbjct: 224 GNVVRAALQIKRA 236 >ref|XP_007047345.1| Cystathionine beta-synthase family protein isoform 4 [Theobroma cacao] gi|508699606|gb|EOX91502.1| Cystathionine beta-synthase family protein isoform 4 [Theobroma cacao] Length = 230 Score = 65.9 bits (159), Expect(2) = 7e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 166 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 201 Score = 27.7 bits (60), Expect(2) = 7e-11 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 127 GNVVRAALQIKRA 165 GNVVRAALQIKRA Sbjct: 213 GNVVRAALQIKRA 225 >ref|XP_007042479.1| Cystathionine beta-synthase family protein [Theobroma cacao] gi|508706414|gb|EOX98310.1| Cystathionine beta-synthase family protein [Theobroma cacao] Length = 230 Score = 64.7 bits (156), Expect(2) = 9e-11 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTP+P+VV ESTNLEDAAR+LLETKYRRLPV+D Sbjct: 166 GDLMTPSPLVVRESTNLEDAARLLLETKYRRLPVVD 201 Score = 28.5 bits (62), Expect(2) = 9e-11 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = +1 Query: 127 GNVVRAALQIKRATK 171 GNVVRAALQIKRA++ Sbjct: 213 GNVVRAALQIKRASE 227 >ref|XP_007206104.1| hypothetical protein PRUPE_ppa012987mg [Prunus persica] gi|462401746|gb|EMJ07303.1| hypothetical protein PRUPE_ppa012987mg [Prunus persica] Length = 146 Score = 66.6 bits (161), Expect(2) = 2e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLDD 112 GD+MTPAPVVV E+TNLED AR+LLETKYRRLPV+DD Sbjct: 82 GDLMTPAPVVVSETTNLEDVARLLLETKYRRLPVVDD 118 Score = 25.8 bits (55), Expect(2) = 2e-10 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 127 GNVVRAALQIKRATK 171 GN++RAALQIK A++ Sbjct: 129 GNIIRAALQIKHASE 143 >ref|XP_004304019.1| PREDICTED: CBS domain-containing protein CBSX1, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 239 Score = 64.7 bits (156), Expect(2) = 2e-10 Identities = 30/36 (83%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAP+VV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 175 GDLMTPAPLVVRETTNLEDAARLLLETKYRRLPVVD 210 Score = 27.3 bits (59), Expect(2) = 2e-10 Identities = 12/15 (80%), Positives = 15/15 (100%) Frame = +1 Query: 127 GNVVRAALQIKRATK 171 GNVV+AALQIKRA++ Sbjct: 222 GNVVKAALQIKRASQ 236 >dbj|BAJ53196.1| JHL03K20.5 [Jatropha curcas] Length = 236 Score = 65.9 bits (159), Expect(2) = 3e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 172 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 207 Score = 25.4 bits (54), Expect(2) = 3e-10 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = +1 Query: 127 GNVVRAALQIKRA 165 GNVVRAAL+IKR+ Sbjct: 219 GNVVRAALEIKRS 231 >ref|XP_002534340.1| conserved hypothetical protein [Ricinus communis] gi|223525462|gb|EEF28042.1| conserved hypothetical protein [Ricinus communis] Length = 239 Score = 65.9 bits (159), Expect(2) = 4e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 2 GDVMTPAPVVVLESTNLEDAARVLLETKYRRLPVLD 109 GD+MTPAPVVV E+TNLEDAAR+LLETKYRRLPV+D Sbjct: 175 GDLMTPAPVVVRETTNLEDAARLLLETKYRRLPVVD 210 Score = 25.0 bits (53), Expect(2) = 4e-10 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = +1 Query: 127 GNVVRAALQIKR 162 GNVVRAAL+IKR Sbjct: 222 GNVVRAALEIKR 233