BLASTX nr result
ID: Mentha24_contig00035877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035877 (367 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004240841.1| PREDICTED: hydroxyacylglutathione hydrolase ... 58 1e-06 ref|XP_006357301.1| PREDICTED: hydroxyacylglutathione hydrolase ... 58 1e-06 gb|ABB29955.1| hydroxyacylglutathione hydrolase cytoplasmic-like... 57 3e-06 ref|XP_007141335.1| hypothetical protein PHAVU_008G187100g [Phas... 55 8e-06 >ref|XP_004240841.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like [Solanum lycopersicum] Length = 258 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 365 MRVDLPEVQEKVGCKSAVEAMLKIRELKNNWKG 267 MRVDLPEVQ+KVGCKS VEAM +IR+ K+NWKG Sbjct: 226 MRVDLPEVQDKVGCKSPVEAMREIRQRKDNWKG 258 >ref|XP_006357301.1| PREDICTED: hydroxyacylglutathione hydrolase cytoplasmic-like [Solanum tuberosum] gi|76573347|gb|ABA46778.1| unknown [Solanum tuberosum] Length = 258 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -3 Query: 365 MRVDLPEVQEKVGCKSAVEAMLKIRELKNNWKG 267 MRVDLPEVQ+KVGCKS VEAM +IR+ K+NWKG Sbjct: 226 MRVDLPEVQDKVGCKSPVEAMREIRQRKDNWKG 258 >gb|ABB29955.1| hydroxyacylglutathione hydrolase cytoplasmic-like [Solanum tuberosum] Length = 258 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -3 Query: 365 MRVDLPEVQEKVGCKSAVEAMLKIRELKNNWKG 267 MRVDLPEVQ+KVGCKS VEAM +IR+ K+NW+G Sbjct: 226 MRVDLPEVQDKVGCKSPVEAMREIRQRKDNWQG 258 >ref|XP_007141335.1| hypothetical protein PHAVU_008G187100g [Phaseolus vulgaris] gi|543176893|gb|AGV54469.1| hydroxyacylglutathione hydrolase [Phaseolus vulgaris] gi|561014468|gb|ESW13329.1| hypothetical protein PHAVU_008G187100g [Phaseolus vulgaris] Length = 258 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/33 (72%), Positives = 30/33 (90%) Frame = -3 Query: 365 MRVDLPEVQEKVGCKSAVEAMLKIRELKNNWKG 267 MRVDLPE+QEKVGCKS VEA+ +IR+ K+NW+G Sbjct: 226 MRVDLPEIQEKVGCKSPVEALGEIRKKKDNWRG 258