BLASTX nr result
ID: Mentha24_contig00035768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035768 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36735.1| hypothetical protein MIMGU_mgv1a003208mg [Mimulus... 59 7e-07 gb|EPS65532.1| hypothetical protein M569_09243, partial [Genlise... 59 7e-07 >gb|EYU36735.1| hypothetical protein MIMGU_mgv1a003208mg [Mimulus guttatus] Length = 600 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/41 (63%), Positives = 31/41 (75%), Gaps = 1/41 (2%) Frame = -3 Query: 341 GSSKTGTSVRNADDP-GNWACDKCTYVNSRSEAACHVCGYR 222 GSSKT +SVRN DD GNWACD+CTY+N+RS C +C R Sbjct: 559 GSSKTSSSVRNTDDSSGNWACDQCTYMNARSSTTCIMCQRR 599 >gb|EPS65532.1| hypothetical protein M569_09243, partial [Genlisea aurea] Length = 611 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/38 (63%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -3 Query: 341 GSSKTGTSVRNADDP-GNWACDKCTYVNSRSEAACHVC 231 GSS+T TS+R+ DD GNWAC++CTYVN R+ A CH+C Sbjct: 572 GSSRTSTSIRSNDDSSGNWACERCTYVNLRTAATCHMC 609