BLASTX nr result
ID: Mentha24_contig00035721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035721 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37847.1| hypothetical protein MIMGU_mgv1a004057mg [Mimulus... 75 1e-11 >gb|EYU37847.1| hypothetical protein MIMGU_mgv1a004057mg [Mimulus guttatus] Length = 547 Score = 75.1 bits (183), Expect = 1e-11 Identities = 41/86 (47%), Positives = 55/86 (63%) Frame = +3 Query: 60 MNLIRAPIHHSFHLNPRTLSRSSNRVSIVSTPVLRISERKYNALFVSNCISPSNEVAETI 239 MNL RAP H+S+H N RT + NR S+ P LRI E K N +++SNCISPS+EV +I Sbjct: 1 MNL-RAPFHYSYHPNFRTTNTKLNRNSVFPKPALRIFELKNNPIYISNCISPSHEVTRSI 59 Query: 240 ARISPIEGGEDGSLDIVEKTQLSGEI 317 +I PIE ++ VE++ L EI Sbjct: 60 DQIPPIEEERKENVAAVEESHLPEEI 85