BLASTX nr result
ID: Mentha24_contig00035720
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035720 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34084.1| hypothetical protein MIMGU_mgv1a012915mg [Mimulus... 56 5e-06 >gb|EYU34084.1| hypothetical protein MIMGU_mgv1a012915mg [Mimulus guttatus] Length = 236 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = +2 Query: 2 DMDAPKVASGVSKPRPRYPSSSDSWPSHILTK*SEMVLFEDV 127 DMD PK S VS+PR RYPSS DSWPSHILT ++ L EDV Sbjct: 196 DMDMPKARSNVSRPRARYPSSYDSWPSHILTT-NQPNLIEDV 236