BLASTX nr result
ID: Mentha24_contig00035705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035705 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25383.1| hypothetical protein MIMGU_mgv1a003872mg [Mimulus... 61 4e-14 >gb|EYU25383.1| hypothetical protein MIMGU_mgv1a003872mg [Mimulus guttatus] Length = 558 Score = 60.8 bits (146), Expect(2) = 4e-14 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +1 Query: 181 ENNVLLGAANSNIYSFSCKGNIKLLMPKTPERKKLGFNVEQEIN 312 +NN++L A N+N+YSFSCKGN+ LLMPK ERKK NV+QEIN Sbjct: 517 QNNLVLKAVNNNLYSFSCKGNLTLLMPKMEERKK--HNVQQEIN 558 Score = 42.4 bits (98), Expect(2) = 4e-14 Identities = 23/47 (48%), Positives = 30/47 (63%) Frame = +3 Query: 36 SATRIQYGKLPLNSGETSRQSCPESSELPHLSPRSTLEVLPRISSAE 176 S T I+ GKLPL +G+ + +S PH SPRSTLE +PR+ S E Sbjct: 459 STTWIKQGKLPLVNGQCCTEQT-DSGANPHNSPRSTLEAVPRVISPE 504