BLASTX nr result
ID: Mentha24_contig00035704
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035704 (436 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25383.1| hypothetical protein MIMGU_mgv1a003872mg [Mimulus... 92 1e-16 >gb|EYU25383.1| hypothetical protein MIMGU_mgv1a003872mg [Mimulus guttatus] Length = 558 Score = 91.7 bits (226), Expect = 1e-16 Identities = 46/83 (55%), Positives = 62/83 (74%), Gaps = 3/83 (3%) Frame = +3 Query: 189 QSCPESSEL---PHLSPRSTLEVLPRISSAELCRSSNSCSPSNVENNVLLGAANSNIYSF 359 Q C E ++ PH SPRSTLE +PR+ S E+ +SN+C PSN++NN++L A N+N+YSF Sbjct: 474 QCCTEQTDSGANPHNSPRSTLEAVPRVISPEVNYNSNNC-PSNIQNNLVLKAVNNNLYSF 532 Query: 360 SCKGNIKLLMPKTPERKKT*LQR 428 SCKGN+ LLMPK ERKK +Q+ Sbjct: 533 SCKGNLTLLMPKMEERKKHNVQQ 555