BLASTX nr result
ID: Mentha24_contig00035693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035693 (548 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007009476.1| Cysteine/Histidine-rich C1 domain family pro... 59 1e-06 ref|XP_007203707.1| hypothetical protein PRUPE_ppa019656mg, part... 59 1e-06 ref|XP_007203919.1| hypothetical protein PRUPE_ppa016986mg [Prun... 58 1e-06 ref|XP_007009467.1| Cysteine/Histidine-rich C1 domain family pro... 56 5e-06 >ref|XP_007009476.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508726389|gb|EOY18286.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 959 Score = 58.5 bits (140), Expect = 1e-06 Identities = 29/67 (43%), Positives = 33/67 (49%), Gaps = 1/67 (1%) Frame = -1 Query: 548 CETKMNPKSWMYHCRRCDLSFHPDCFPLTSGGYRNIKLGQEYSIATAHPHAL-TYQLLIT 372 CE + NP W YHC CD S HP C G Y IKLG+ S T HPH+L Q + Sbjct: 563 CEKRRNPNIWFYHCALCDKSAHPKC---VLGDYSFIKLGRRISAKTDHPHSLILVQKVYL 619 Query: 371 KRRCDTC 351 C C Sbjct: 620 YPECSKC 626 >ref|XP_007203707.1| hypothetical protein PRUPE_ppa019656mg, partial [Prunus persica] gi|462399238|gb|EMJ04906.1| hypothetical protein PRUPE_ppa019656mg, partial [Prunus persica] Length = 524 Score = 58.5 bits (140), Expect = 1e-06 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 11/102 (10%) Frame = -1 Query: 548 CETKMNPKSWMYHCRRCDLSFHPDCFPLTSGGYRNIKLGQEYSIATAHPHALTY-----Q 384 CE + +P+ W Y C CD +FHPDC G Y IKLG Y + AHPH +T Sbjct: 422 CEGEGDPEYWFYSCEDCDFNFHPDC---VLGRYPQIKLGSTYKL-DAHPHPVTLVDKIKS 477 Query: 383 LLITKRR------CDTCHTDGCYGWRGFMCASCNFFVCFDNC 276 ++ +R C CH + C G + C+ CN + + C Sbjct: 478 VIPNDKRYKDISPCVECH-EPCEG-LVYECSECNINIHRNGC 517 >ref|XP_007203919.1| hypothetical protein PRUPE_ppa016986mg [Prunus persica] gi|462399450|gb|EMJ05118.1| hypothetical protein PRUPE_ppa016986mg [Prunus persica] Length = 579 Score = 58.2 bits (139), Expect = 1e-06 Identities = 41/111 (36%), Positives = 47/111 (42%), Gaps = 13/111 (11%) Frame = -1 Query: 548 CETKMNPKSWMYHCRRCDLSFHPDCFPLTSGGYRNIKLGQEYSIATAHPHALTYQLLITK 369 CE K +PK W Y C CD HP C G Y +KLG Y AHPH +T L+ K Sbjct: 472 CEGKRDPKLWFYSCSDCDFDCHPHCI---LGRYPQVKLGDSYK-HPAHPHLVT---LVDK 524 Query: 368 RR-------------CDTCHTDGCYGWRGFMCASCNFFVCFDNCGRNMDGD 255 RR CD C + C G F C+ CN N R D D Sbjct: 525 RRSEIPFHKRERILPCDKC-SKPCEG-LVFECSECNI-----NLHRECDED 568 >ref|XP_007009467.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] gi|508726380|gb|EOY18277.1| Cysteine/Histidine-rich C1 domain family protein, putative [Theobroma cacao] Length = 667 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/69 (46%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = -1 Query: 548 CETKMNPKSWMYHCRRCDLSFHPDCFPLTSGGYRNIKLGQEYSIATAHPHALTYQLLITK 369 CE K NP W YHC CD S HP C G Y +KLG Y I + HPH LT+ TK Sbjct: 581 CEKKRNPNYWFYHCVICDNSIHPKC---VIGRYSFMKLGHTY-IKSYHPHPLTF----TK 632 Query: 368 RRCD--TCH 348 + D CH Sbjct: 633 KVYDYPECH 641