BLASTX nr result
ID: Mentha24_contig00035603
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035603 (487 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB54536.1| putative ethanolamine kinase A [Morus notabilis] 61 1e-07 ref|XP_006367512.1| PREDICTED: probable ethanolamine kinase-like... 57 2e-06 ref|XP_004245179.1| PREDICTED: probable ethanolamine kinase A-li... 57 2e-06 ref|XP_002524470.1| choline/ethanolamine kinase, putative [Ricin... 57 3e-06 ref|XP_006450962.1| hypothetical protein CICLE_v10008632mg [Citr... 55 8e-06 ref|XP_006450957.1| hypothetical protein CICLE_v10008632mg [Citr... 55 8e-06 >gb|EXB54536.1| putative ethanolamine kinase A [Morus notabilis] Length = 384 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 485 PIDFDYLSYFFLRYNEYKKQKANSFSLARSY 393 PIDFDY+ YFFLRYNEYKKQK SFSLARSY Sbjct: 347 PIDFDYVGYFFLRYNEYKKQKEKSFSLARSY 377 >ref|XP_006367512.1| PREDICTED: probable ethanolamine kinase-like [Solanum tuberosum] Length = 372 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 485 PIDFDYLSYFFLRYNEYKKQKANSFSLARSY 393 PIDFDY+SYFFLRYNEYKKQK SLA+SY Sbjct: 331 PIDFDYISYFFLRYNEYKKQKEKVLSLAKSY 361 >ref|XP_004245179.1| PREDICTED: probable ethanolamine kinase A-like [Solanum lycopersicum] Length = 372 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 485 PIDFDYLSYFFLRYNEYKKQKANSFSLARSY 393 PIDFDY+SYFFLRYNEYKKQK SLA+SY Sbjct: 331 PIDFDYISYFFLRYNEYKKQKEKVLSLAKSY 361 >ref|XP_002524470.1| choline/ethanolamine kinase, putative [Ricinus communis] gi|223536258|gb|EEF37910.1| choline/ethanolamine kinase, putative [Ricinus communis] Length = 326 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 485 PIDFDYLSYFFLRYNEYKKQKANSFSLARSY 393 PI+FDYL YFFLRYNEYK+QK S SLARSY Sbjct: 289 PIEFDYLGYFFLRYNEYKRQKEKSCSLARSY 319 >ref|XP_006450962.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|557554188|gb|ESR64202.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] Length = 249 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 485 PIDFDYLSYFFLRYNEYKKQKANSFSLARSY 393 PIDFDYL YFFLRYNEYKKQK SLA+SY Sbjct: 208 PIDFDYLGYFFLRYNEYKKQKEMCVSLAQSY 238 >ref|XP_006450957.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] gi|568843870|ref|XP_006475821.1| PREDICTED: probable ethanolamine kinase-like [Citrus sinensis] gi|557554183|gb|ESR64197.1| hypothetical protein CICLE_v10008632mg [Citrus clementina] Length = 382 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -3 Query: 485 PIDFDYLSYFFLRYNEYKKQKANSFSLARSY 393 PIDFDYL YFFLRYNEYKKQK SLA+SY Sbjct: 341 PIDFDYLGYFFLRYNEYKKQKEMCVSLAQSY 371