BLASTX nr result
ID: Mentha24_contig00035474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035474 (352 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23296.1| hypothetical protein MIMGU_mgv1a021531mg, partial... 57 2e-06 gb|EYU20260.1| hypothetical protein MIMGU_mgv1a019266mg, partial... 57 3e-06 gb|EYU20304.1| hypothetical protein MIMGU_mgv1a007132mg [Mimulus... 56 6e-06 >gb|EYU23296.1| hypothetical protein MIMGU_mgv1a021531mg, partial [Mimulus guttatus] Length = 325 Score = 57.4 bits (137), Expect = 2e-06 Identities = 34/64 (53%), Positives = 43/64 (67%) Frame = -1 Query: 193 MAGGKCSSLLYMNSRRTRPYYFRRCKRAGPRPTEIDSLPDELISCILLRLPAHHLHDIAR 14 M GKC+S+ Y N+R TRPYY RRCK + T+ DSLPDEL+ ILL L +H+ AR Sbjct: 1 MNWGKCNSV-YTNTR-TRPYYSRRCKSS---LTKFDSLPDELVFEILLLLSPKDIHNGAR 55 Query: 13 FVCR 2 VC+ Sbjct: 56 LVCK 59 >gb|EYU20260.1| hypothetical protein MIMGU_mgv1a019266mg, partial [Mimulus guttatus] Length = 413 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = -1 Query: 214 EGNSNTLMAGGKCSSLLYMNSRRTRPYYFRRCK-RAGPRPTEIDSLPDELISCILLRLPA 38 E N M GKC+ R+RPYYFRRCK + T I+SLP+E++S ILL L A Sbjct: 2 EHNMQKKMDFGKCNP-------RSRPYYFRRCKYKCFSSTTNIESLPEEMVSRILLELDA 54 Query: 37 HHLHDIARFVCR 2 +++ A VCR Sbjct: 55 EEIYESAMLVCR 66 >gb|EYU20304.1| hypothetical protein MIMGU_mgv1a007132mg [Mimulus guttatus] Length = 418 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/52 (51%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -1 Query: 154 SRRTRPYYFRRCK-RAGPRPTEIDSLPDELISCILLRLPAHHLHDIARFVCR 2 +RR+RPYYFRRCK + T I+SLPDE++ ILL+L A +++ A VCR Sbjct: 19 NRRSRPYYFRRCKHKCLSSTTSIESLPDEIVFQILLQLEAEEIYESAMLVCR 70