BLASTX nr result
ID: Mentha24_contig00035359
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035359 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36989.1| hypothetical protein MIMGU_mgv1a0001571mg, partia... 80 3e-13 >gb|EYU36989.1| hypothetical protein MIMGU_mgv1a0001571mg, partial [Mimulus guttatus] Length = 351 Score = 80.1 bits (196), Expect = 3e-13 Identities = 50/98 (51%), Positives = 63/98 (64%), Gaps = 1/98 (1%) Frame = -2 Query: 292 KLPVRRQIKQENDIYSPFQVNMPAPPEANVLNSSGKLPVRRHMKKENNSDNYSAVN-PHQ 116 KLPVRR IKQE D S FQV + AP E NV + + KL +RRH+K+ENNSD +S +N + Sbjct: 131 KLPVRRHIKQEMD--SSFQVGISAPCETNVSHPTEKLVIRRHIKRENNSDFHSPINSTFE 188 Query: 115 VETPSPLEANPPGSILDSLSSEIPWDVSNSNGSFDDGI 2 VE P+P EAN L ++ WDV S G+FDD I Sbjct: 189 VEVPNPSEANAVQED-PLLPNQAQWDV--SKGNFDDVI 223