BLASTX nr result
ID: Mentha24_contig00035357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035357 (456 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007034303.1| Ribonuclease P family protein / Rpp14 family... 58 2e-06 ref|XP_006374073.1| hypothetical protein POPTR_0015s00370g [Popu... 56 6e-06 gb|EPS70583.1| hypothetical protein M569_04177, partial [Genlise... 56 6e-06 >ref|XP_007034303.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|590656557|ref|XP_007034304.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|590656560|ref|XP_007034305.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|590656564|ref|XP_007034306.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|590656568|ref|XP_007034307.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|590656572|ref|XP_007034308.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|508713332|gb|EOY05229.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|508713333|gb|EOY05230.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|508713334|gb|EOY05231.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|508713335|gb|EOY05232.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|508713336|gb|EOY05233.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] gi|508713337|gb|EOY05234.1| Ribonuclease P family protein / Rpp14 family protein isoform 1 [Theobroma cacao] Length = 154 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -3 Query: 454 DELKFEQYKLSAGDRLPATAHQEMQNCLEKIKILEH 347 DELKFEQYKL G RL A Q MQNCLEKIKILEH Sbjct: 119 DELKFEQYKLMVGARLSADVTQHMQNCLEKIKILEH 154 >ref|XP_006374073.1| hypothetical protein POPTR_0015s00370g [Populus trichocarpa] gi|550321656|gb|ERP51870.1| hypothetical protein POPTR_0015s00370g [Populus trichocarpa] Length = 67 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 454 DELKFEQYKLSAGDRLPATAHQEMQNCLEKIKILEH 347 DE+KFE YKL+AG L A +Q MQNCLEKIKILEH Sbjct: 32 DEMKFEHYKLAAGAPLSADVNQHMQNCLEKIKILEH 67 >gb|EPS70583.1| hypothetical protein M569_04177, partial [Genlisea aurea] Length = 153 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = -3 Query: 454 DELKFEQYKLSAGDRLPATAHQEMQNCLEKIKILE 350 DE+KFEQYKLSAGD LPA A Q MQN +EKIK LE Sbjct: 119 DEMKFEQYKLSAGDSLPADAPQRMQNFVEKIKFLE 153