BLASTX nr result
ID: Mentha24_contig00035294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035294 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23346.1| hypothetical protein MIMGU_mgv1a016905mg [Mimulus... 56 6e-06 >gb|EYU23346.1| hypothetical protein MIMGU_mgv1a016905mg [Mimulus guttatus] Length = 102 Score = 55.8 bits (133), Expect = 6e-06 Identities = 28/49 (57%), Positives = 34/49 (69%), Gaps = 5/49 (10%) Frame = -2 Query: 309 QKTQGKKFEELMEEIQRSRERD-----VGWKPSLDSIVEIPEVPEGMDR 178 Q + K+ E+L+ EI+ R R V WKPSLDSIVEIPEVP+GMDR Sbjct: 53 QNKEVKRIEDLLGEIELQRSRQKINVVVNWKPSLDSIVEIPEVPDGMDR 101