BLASTX nr result
ID: Mentha24_contig00035140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00035140 (380 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004304180.1| PREDICTED: sodium-coupled neutral amino acid... 65 8e-09 ref|XP_006338315.1| PREDICTED: probable sodium-coupled neutral a... 63 4e-08 ref|XP_004232123.1| PREDICTED: sodium-coupled neutral amino acid... 63 4e-08 ref|XP_004152822.1| PREDICTED: probable sodium-coupled neutral a... 60 3e-07 gb|EYU44254.1| hypothetical protein MIMGU_mgv1a005959mg [Mimulus... 60 4e-07 gb|EXB77624.1| hypothetical protein L484_018140 [Morus notabilis] 60 4e-07 ref|XP_007215352.1| hypothetical protein PRUPE_ppa005464mg [Prun... 60 4e-07 ref|XP_007215351.1| hypothetical protein PRUPE_ppa005464mg [Prun... 60 4e-07 ref|XP_007032927.1| Transmembrane amino acid transporter family ... 59 5e-07 ref|XP_006482461.1| PREDICTED: probable sodium-coupled neutral a... 59 7e-07 ref|XP_006430991.1| hypothetical protein CICLE_v10011669mg [Citr... 59 7e-07 ref|XP_006384246.1| amino acid transporter family protein [Popul... 59 7e-07 ref|XP_007139375.1| hypothetical protein PHAVU_008G024100g [Phas... 58 2e-06 ref|XP_003531894.1| PREDICTED: probable sodium-coupled neutral a... 57 2e-06 ref|XP_003621604.1| Amino acid transporter [Medicago truncatula]... 57 2e-06 ref|XP_006373526.1| amino acid transporter family protein [Popul... 57 2e-06 ref|XP_003555022.1| PREDICTED: sodium-coupled neutral amino acid... 57 3e-06 ref|XP_003552624.1| PREDICTED: probable sodium-coupled neutral a... 57 3e-06 gb|EPS73191.1| hypothetical protein M569_01565, partial [Genlise... 57 4e-06 ref|XP_006365650.1| PREDICTED: sodium-coupled neutral amino acid... 56 5e-06 >ref|XP_004304180.1| PREDICTED: sodium-coupled neutral amino acid transporter 3-like [Fragaria vesca subsp. vesca] Length = 463 Score = 65.5 bits (158), Expect = 8e-09 Identities = 31/42 (73%), Positives = 40/42 (95%), Gaps = 2/42 (4%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKN--SPAPRE 259 +TK+D+IL+IVMI+LA+FSNV+AIYSDAYALFKN +P+PRE Sbjct: 422 ATKKDKILSIVMIVLAVFSNVVAIYSDAYALFKNAKTPSPRE 463 >ref|XP_006338315.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like isoform X1 [Solanum tuberosum] Length = 459 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/40 (70%), Positives = 37/40 (92%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TKRD+IL+I MI+LA+FSN++AIYSDAYALFK + +PRE Sbjct: 420 ATKRDKILSIFMIVLAVFSNMVAIYSDAYALFKKNSSPRE 459 >ref|XP_004232123.1| PREDICTED: sodium-coupled neutral amino acid transporter 3-like [Solanum lycopersicum] Length = 460 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/40 (70%), Positives = 37/40 (92%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TKRD+IL+I MI+LA+FSN++AIYSDAYALFK + +PRE Sbjct: 421 ATKRDKILSIFMIVLAVFSNMVAIYSDAYALFKKNSSPRE 460 >ref|XP_004152822.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Cucumis sativus] gi|449477713|ref|XP_004155101.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Cucumis sativus] Length = 462 Score = 60.1 bits (144), Expect = 3e-07 Identities = 24/40 (60%), Positives = 35/40 (87%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TK+D++L + M++LA+FSN+IAIYSDAYALFK +PR+ Sbjct: 423 ATKKDKVLGVFMVVLAVFSNIIAIYSDAYALFKRDSSPRD 462 >gb|EYU44254.1| hypothetical protein MIMGU_mgv1a005959mg [Mimulus guttatus] gi|604345758|gb|EYU44255.1| hypothetical protein MIMGU_mgv1a005959mg [Mimulus guttatus] Length = 463 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/40 (62%), Positives = 35/40 (87%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 + K+D +L+I M++LA+FSNV+AIYSDAY+LFKN P+ RE Sbjct: 424 AAKKDTVLSIFMVVLAVFSNVVAIYSDAYSLFKNGPSHRE 463 >gb|EXB77624.1| hypothetical protein L484_018140 [Morus notabilis] Length = 463 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 36/40 (90%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TK+D++L + MI+LA+FSN++AIYSDAY+LFK + +PRE Sbjct: 424 ATKKDKVLCVFMIVLAVFSNLVAIYSDAYSLFKKNASPRE 463 >ref|XP_007215352.1| hypothetical protein PRUPE_ppa005464mg [Prunus persica] gi|462411502|gb|EMJ16551.1| hypothetical protein PRUPE_ppa005464mg [Prunus persica] Length = 460 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 34/35 (97%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNS 274 +TK+D+IL++ MI+LA+FSNV+AIYSDAYALFKNS Sbjct: 422 ATKKDKILSVFMIVLAVFSNVVAIYSDAYALFKNS 456 >ref|XP_007215351.1| hypothetical protein PRUPE_ppa005464mg [Prunus persica] gi|462411501|gb|EMJ16550.1| hypothetical protein PRUPE_ppa005464mg [Prunus persica] Length = 392 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/35 (74%), Positives = 34/35 (97%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNS 274 +TK+D+IL++ MI+LA+FSNV+AIYSDAYALFKNS Sbjct: 354 ATKKDKILSVFMIVLAVFSNVVAIYSDAYALFKNS 388 >ref|XP_007032927.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] gi|590651574|ref|XP_007032928.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] gi|508711956|gb|EOY03853.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] gi|508711957|gb|EOY03854.1| Transmembrane amino acid transporter family protein isoform 1 [Theobroma cacao] Length = 464 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSP 271 +TK+D+ILAI MI+LA+FSN++AIYSDAYALFK +P Sbjct: 423 ATKKDKILAIFMIVLAVFSNLVAIYSDAYALFKKNP 458 >ref|XP_006482461.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Citrus sinensis] Length = 462 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TK+D+IL I MI+LA+FSNV+AIYSDA+ALFK + +P E Sbjct: 423 ATKKDKILCIFMIVLAVFSNVVAIYSDAFALFKKNASPSE 462 >ref|XP_006430991.1| hypothetical protein CICLE_v10011669mg [Citrus clementina] gi|557533048|gb|ESR44231.1| hypothetical protein CICLE_v10011669mg [Citrus clementina] Length = 462 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TK+D+IL I MI+LA+FSNV+AIYSDA+ALFK + +P E Sbjct: 423 ATKKDKILCIFMIVLAVFSNVVAIYSDAFALFKKNASPSE 462 >ref|XP_006384246.1| amino acid transporter family protein [Populus trichocarpa] gi|550340792|gb|ERP62043.1| amino acid transporter family protein [Populus trichocarpa] Length = 460 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 ++KRD+IL I MI LA+FSN +AIYSDAYAL K +P+PRE Sbjct: 421 ASKRDKILCIFMIALAVFSNGVAIYSDAYALIKKNPSPRE 460 >ref|XP_007139375.1| hypothetical protein PHAVU_008G024100g [Phaseolus vulgaris] gi|561012508|gb|ESW11369.1| hypothetical protein PHAVU_008G024100g [Phaseolus vulgaris] Length = 466 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/40 (65%), Positives = 34/40 (85%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TK D+IL++VMI+LA+FSNV+AIYSDAYAL K + RE Sbjct: 427 ATKSDKILSVVMIVLAVFSNVVAIYSDAYALIKQNQTSRE 466 >ref|XP_003531894.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Glycine max] Length = 466 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TK D+IL+++MI+LA+FSNV+AIYSDAYAL K + RE Sbjct: 427 ATKSDKILSVIMIVLAVFSNVVAIYSDAYALIKQNKTSRE 466 >ref|XP_003621604.1| Amino acid transporter [Medicago truncatula] gi|355496619|gb|AES77822.1| Amino acid transporter [Medicago truncatula] Length = 467 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TK D+IL +VMI+LA+FSNV+AIYSDAYAL K + RE Sbjct: 428 ATKSDKILCVVMIVLAVFSNVVAIYSDAYALIKQNKTSRE 467 >ref|XP_006373526.1| amino acid transporter family protein [Populus trichocarpa] gi|550320348|gb|ERP51323.1| amino acid transporter family protein [Populus trichocarpa] Length = 460 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TKRD+IL I MI+LA+FSN +AIYSDAYAL K +P+ E Sbjct: 421 ATKRDKILCIFMIVLAVFSNAVAIYSDAYALIKRNPSHSE 460 >ref|XP_003555022.1| PREDICTED: sodium-coupled neutral amino acid transporter 1-like [Glycine max] Length = 464 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/39 (61%), Positives = 34/39 (87%) Frame = -3 Query: 375 TKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 TK+D+IL++ MI+LA+F+NV+A+YSDA+AL KNS RE Sbjct: 426 TKKDKILSVFMIVLAVFANVVAVYSDAFALIKNSTTKRE 464 >ref|XP_003552624.1| PREDICTED: probable sodium-coupled neutral amino acid transporter 6-like [Glycine max] Length = 465 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TK D+IL ++MI+LA+FSNV+AIYSDAYAL K + RE Sbjct: 426 ATKSDKILCVIMIVLAVFSNVVAIYSDAYALIKQNKTSRE 465 >gb|EPS73191.1| hypothetical protein M569_01565, partial [Genlisea aurea] Length = 465 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/37 (64%), Positives = 34/37 (91%) Frame = -3 Query: 372 KRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPR 262 +RD++L++ +IILA+FSNV+AIYSDAY+LFKN P+ R Sbjct: 428 RRDKMLSLFLIILAVFSNVVAIYSDAYSLFKNGPSRR 464 >ref|XP_006365650.1| PREDICTED: sodium-coupled neutral amino acid transporter 5-like [Solanum tuberosum] Length = 463 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = -3 Query: 378 STKRDRILAIVMIILAIFSNVIAIYSDAYALFKNSPAPRE 259 +TK+D+IL I MI++A+FSNV+AIYSDAY+L K + +P E Sbjct: 424 ATKKDKILCIFMIVIAVFSNVVAIYSDAYSLIKKNSSPSE 463