BLASTX nr result
ID: Mentha24_contig00034323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00034323 (449 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29569.1| hypothetical protein MIMGU_mgv1a022751mg, partial... 56 4e-06 >gb|EYU29569.1| hypothetical protein MIMGU_mgv1a022751mg, partial [Mimulus guttatus] Length = 124 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/60 (48%), Positives = 33/60 (55%) Frame = -3 Query: 180 MEYXXXXXXXXXXXXXXXTAGDDYSCSDQFLGFNIWKGNGXXXXXXXXXCGYVMKDFFPS 1 MEY TAGDD SCS+ F+GF+IWK NG CGYVMKDFFP+ Sbjct: 1 MEYSGSSNSSIVNLETSSTAGDDNSCSNHFVGFDIWKSNGEYEESEKSSCGYVMKDFFPA 60