BLASTX nr result
ID: Mentha24_contig00034290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00034290 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38680.1| hypothetical protein MIMGU_mgv1a024061mg [Mimulus... 59 5e-07 gb|EYU18100.1| hypothetical protein MIMGU_mgv1a016320mg [Mimulus... 56 5e-06 >gb|EYU38680.1| hypothetical protein MIMGU_mgv1a024061mg [Mimulus guttatus] Length = 161 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/59 (54%), Positives = 36/59 (61%) Frame = -1 Query: 337 NRLVKQAARAYLTPMSAFPTSADGNFFRRLWTGVAALIDLFCSTAVRILHGAIRAVRIR 161 NRLVKQAA AYL PMS P SA GN F RL VAA D +R L+ +R +RIR Sbjct: 99 NRLVKQAAWAYLQPMSTSPGSAGGNLFNRLCPPVAAFFDFVGQNLIRALNWMLRVIRIR 157 >gb|EYU18100.1| hypothetical protein MIMGU_mgv1a016320mg [Mimulus guttatus] Length = 126 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/59 (47%), Positives = 34/59 (57%) Frame = -1 Query: 337 NRLVKQAARAYLTPMSAFPTSADGNFFRRLWTGVAALIDLFCSTAVRILHGAIRAVRIR 161 NRLV+QAA AYL P S P GN +RLW AA +D C +R L G +R R+R Sbjct: 61 NRLVEQAACAYLRPASITPDFDGGNCCQRLWNRAAAFVDFVCGWIIRALDGTLRFFRVR 119