BLASTX nr result
ID: Mentha24_contig00034225
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00034225 (433 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515795.1| Pre-mRNA-processing protein PRP40, putative ... 59 7e-07 gb|EXC33082.1| Transcription elongation regulator 1 [Morus notab... 58 2e-06 >ref|XP_002515795.1| Pre-mRNA-processing protein PRP40, putative [Ricinus communis] gi|223545064|gb|EEF46576.1| Pre-mRNA-processing protein PRP40, putative [Ricinus communis] Length = 886 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/63 (44%), Positives = 36/63 (57%) Frame = +3 Query: 3 PRYNKMARKEREALWRRHADEILRXXXXXXXXXXXXXXXXXKTKTSIDSGKHSSALRRPY 182 PRYNKM RKERE LWRRHA+++LR ++ DSG+H S +R + Sbjct: 824 PRYNKMPRKEREVLWRRHAEDMLRKQKTTLDEKEDKHTDPRGRSSTTDSGRHLSGSKRTH 883 Query: 183 DRR 191 DRR Sbjct: 884 DRR 886 >gb|EXC33082.1| Transcription elongation regulator 1 [Morus notabilis] Length = 829 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/63 (42%), Positives = 38/63 (60%) Frame = +3 Query: 3 PRYNKMARKEREALWRRHADEILRXXXXXXXXXXXXXXXXXKTKTSIDSGKHSSALRRPY 182 PRYNKM RK+RE LWRR+A+++LR + +TS+DSG+ S LR + Sbjct: 767 PRYNKMPRKDRETLWRRYAEDMLRKQQKSEPNSKEDKKIDPRNRTSVDSGRLPSGLRGTH 826 Query: 183 DRR 191 +RR Sbjct: 827 ERR 829