BLASTX nr result
ID: Mentha24_contig00034013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00034013 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006482451.1| PREDICTED: riboflavin synthase-like isoform ... 81 2e-13 ref|XP_006430973.1| hypothetical protein CICLE_v10013903mg [Citr... 81 2e-13 ref|XP_002274029.1| PREDICTED: riboflavin synthase alpha chain [... 79 9e-13 gb|EYU22747.1| hypothetical protein MIMGU_mgv1a011260mg [Mimulus... 78 1e-12 ref|XP_006357493.1| PREDICTED: riboflavin synthase-like [Solanum... 78 1e-12 ref|XP_004243342.1| PREDICTED: riboflavin synthase-like [Solanum... 78 1e-12 gb|AHF22111.1| riboflavin synthase [Lycium chinense] 77 3e-12 ref|XP_007029000.1| Riboflavin synthase alpha chain, putative is... 77 3e-12 ref|XP_007198837.1| hypothetical protein PRUPE_ppa009738mg [Prun... 76 4e-12 ref|XP_004301447.1| PREDICTED: riboflavin synthase-like [Fragari... 76 6e-12 ref|XP_002517920.1| Riboflavin synthase alpha chain, putative [R... 75 1e-11 gb|EXC25510.1| Riboflavin synthase alpha chain [Morus notabilis] 75 1e-11 ref|XP_004506614.1| PREDICTED: riboflavin synthase-like [Cicer a... 71 1e-10 ref|XP_007132661.1| hypothetical protein PHAVU_011G114100g [Phas... 69 5e-10 ref|XP_003539920.1| PREDICTED: riboflavin synthase-like [Glycine... 69 7e-10 ref|XP_006371563.1| hypothetical protein POPTR_0019s13180g [Popu... 64 2e-08 ref|XP_006376497.1| hypothetical protein POPTR_0013s13530g [Popu... 62 8e-08 ref|XP_006298297.1| hypothetical protein CARUB_v10014362mg [Caps... 61 1e-07 gb|AFZ99647.1| riboflavin synthase [Momordica charantia] 61 2e-07 ref|NP_565482.1| lumazine-binding family protein [Arabidopsis th... 61 2e-07 >ref|XP_006482451.1| PREDICTED: riboflavin synthase-like isoform X1 [Citrus sinensis] gi|568857800|ref|XP_006482452.1| PREDICTED: riboflavin synthase-like isoform X2 [Citrus sinensis] Length = 282 Score = 80.9 bits (198), Expect = 2e-13 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQKVVI LKKVGQKVNLEVDILGKYVERLLS GFVDSFK+S Sbjct: 238 AYTQQKVVIPLKKVGQKVNLEVDILGKYVERLLSSGFVDSFKAS 281 >ref|XP_006430973.1| hypothetical protein CICLE_v10013903mg [Citrus clementina] gi|567876769|ref|XP_006430974.1| hypothetical protein CICLE_v10013903mg [Citrus clementina] gi|557533030|gb|ESR44213.1| hypothetical protein CICLE_v10013903mg [Citrus clementina] gi|557533031|gb|ESR44214.1| hypothetical protein CICLE_v10013903mg [Citrus clementina] Length = 282 Score = 80.9 bits (198), Expect = 2e-13 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQKVVI LKKVGQKVNLEVDILGKYVERLLS GFVDSFK+S Sbjct: 238 AYTQQKVVIPLKKVGQKVNLEVDILGKYVERLLSSGFVDSFKAS 281 >ref|XP_002274029.1| PREDICTED: riboflavin synthase alpha chain [Vitis vinifera] Length = 280 Score = 78.6 bits (192), Expect = 9e-13 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQKVVI LKKVGQKVNLEVDILGKYVERLLS GFVDS K+S Sbjct: 237 AYTQQKVVIPLKKVGQKVNLEVDILGKYVERLLSSGFVDSIKAS 280 >gb|EYU22747.1| hypothetical protein MIMGU_mgv1a011260mg [Mimulus guttatus] Length = 287 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/44 (90%), Positives = 40/44 (90%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQ VVI LKKVGQKVNLEVDILGKYVERLLS GFVDS KSS Sbjct: 244 AYTQQNVVIPLKKVGQKVNLEVDILGKYVERLLSSGFVDSIKSS 287 >ref|XP_006357493.1| PREDICTED: riboflavin synthase-like [Solanum tuberosum] Length = 280 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/44 (90%), Positives = 40/44 (90%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQ VVI LKKVGQKVNLEVDILGKYVERLLS GFVDS KSS Sbjct: 237 AYTQQNVVIPLKKVGQKVNLEVDILGKYVERLLSSGFVDSIKSS 280 >ref|XP_004243342.1| PREDICTED: riboflavin synthase-like [Solanum lycopersicum] Length = 280 Score = 77.8 bits (190), Expect = 1e-12 Identities = 40/44 (90%), Positives = 40/44 (90%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQ VVI LKKVGQKVNLEVDILGKYVERLLS GFVDS KSS Sbjct: 237 AYTQQNVVIPLKKVGQKVNLEVDILGKYVERLLSSGFVDSIKSS 280 >gb|AHF22111.1| riboflavin synthase [Lycium chinense] Length = 285 Score = 77.0 bits (188), Expect = 3e-12 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQ VVI +KKVGQKVNLEVDILGKYVERLLS GFVDS KSS Sbjct: 242 AYTQQNVVIPMKKVGQKVNLEVDILGKYVERLLSSGFVDSIKSS 285 >ref|XP_007029000.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|590637019|ref|XP_007029001.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|590637022|ref|XP_007029002.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|508717605|gb|EOY09502.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|508717606|gb|EOY09503.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] gi|508717607|gb|EOY09504.1| Riboflavin synthase alpha chain, putative isoform 1 [Theobroma cacao] Length = 279 Score = 76.6 bits (187), Expect = 3e-12 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQKVVI LK+VGQKVNLEVDILGKYVERLLS GFVDS K S Sbjct: 236 AYTQQKVVIPLKEVGQKVNLEVDILGKYVERLLSSGFVDSIKGS 279 >ref|XP_007198837.1| hypothetical protein PRUPE_ppa009738mg [Prunus persica] gi|462394132|gb|EMJ00036.1| hypothetical protein PRUPE_ppa009738mg [Prunus persica] Length = 280 Score = 76.3 bits (186), Expect = 4e-12 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQ VVI LKKVGQKVNLEVDILGKYVERLLS GFV+S KSS Sbjct: 237 AYTQQNVVIPLKKVGQKVNLEVDILGKYVERLLSSGFVESIKSS 280 >ref|XP_004301447.1| PREDICTED: riboflavin synthase-like [Fragaria vesca subsp. vesca] Length = 282 Score = 75.9 bits (185), Expect = 6e-12 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKS 199 AYTQQKVVI LKKVGQKVNLEVDILGKYVERLL+ GF+DS KS Sbjct: 239 AYTQQKVVIPLKKVGQKVNLEVDILGKYVERLLTSGFLDSIKS 281 >ref|XP_002517920.1| Riboflavin synthase alpha chain, putative [Ricinus communis] gi|223542902|gb|EEF44438.1| Riboflavin synthase alpha chain, putative [Ricinus communis] Length = 286 Score = 75.1 bits (183), Expect = 1e-11 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQKVVI LK VGQKVNLEVDILGKYVERLLS GFV+S K+S Sbjct: 243 AYTQQKVVIPLKNVGQKVNLEVDILGKYVERLLSSGFVESIKAS 286 >gb|EXC25510.1| Riboflavin synthase alpha chain [Morus notabilis] Length = 280 Score = 74.7 bits (182), Expect = 1e-11 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQKVVI LKK+GQKVNLEVDI+GKYVERLLS FVDS KSS Sbjct: 237 AYTQQKVVIPLKKIGQKVNLEVDIMGKYVERLLSSVFVDSVKSS 280 >ref|XP_004506614.1| PREDICTED: riboflavin synthase-like [Cicer arietinum] Length = 277 Score = 71.2 bits (173), Expect = 1e-10 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKS 199 AYTQQK+VI KKVGQKVNLEVDILGKYVERLLS GFV S S Sbjct: 233 AYTQQKIVIPTKKVGQKVNLEVDILGKYVERLLSSGFVQSIAS 275 >ref|XP_007132661.1| hypothetical protein PHAVU_011G114100g [Phaseolus vulgaris] gi|561005661|gb|ESW04655.1| hypothetical protein PHAVU_011G114100g [Phaseolus vulgaris] Length = 274 Score = 69.3 bits (168), Expect = 5e-10 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKSS 196 AYTQQKVVI LK VG K+NLEVDILGKYVERLL GFV SF +S Sbjct: 230 AYTQQKVVIPLKNVGDKLNLEVDILGKYVERLLRSGFVSSFTNS 273 >ref|XP_003539920.1| PREDICTED: riboflavin synthase-like [Glycine max] Length = 275 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSF 205 AYTQQKVVI LK VG+KVNLEVDILGKYVERLL+ GF SF Sbjct: 232 AYTQQKVVIPLKNVGEKVNLEVDILGKYVERLLASGFASSF 272 >ref|XP_006371563.1| hypothetical protein POPTR_0019s13180g [Populus trichocarpa] gi|550317442|gb|ERP49360.1| hypothetical protein POPTR_0019s13180g [Populus trichocarpa] Length = 264 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRG 220 AYTQQKVV+ LK+VGQKVNLEVDILG+YVERLLS G Sbjct: 217 AYTQQKVVVPLKEVGQKVNLEVDILGRYVERLLSSG 252 >ref|XP_006376497.1| hypothetical protein POPTR_0013s13530g [Populus trichocarpa] gi|118484875|gb|ABK94304.1| unknown [Populus trichocarpa] gi|550325773|gb|ERP54294.1| hypothetical protein POPTR_0013s13530g [Populus trichocarpa] Length = 274 Score = 62.0 bits (149), Expect = 8e-08 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLS 226 +YTQQKVV+ LK+VGQKVNLEVDILGKYVERLLS Sbjct: 238 SYTQQKVVVPLKEVGQKVNLEVDILGKYVERLLS 271 >ref|XP_006298297.1| hypothetical protein CARUB_v10014362mg [Capsella rubella] gi|482567006|gb|EOA31195.1| hypothetical protein CARUB_v10014362mg [Capsella rubella] Length = 276 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRG 220 AYTQQ VVI KKVGQKVNLEVDI+GKYVERLL+ G Sbjct: 229 AYTQQNVVIPTKKVGQKVNLEVDIMGKYVERLLTSG 264 >gb|AFZ99647.1| riboflavin synthase [Momordica charantia] Length = 282 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRGFVDSFKS 199 AYTQ VVI LKKVG VNLEVDILGKYV+RLLS G + KS Sbjct: 239 AYTQNSVVIPLKKVGDLVNLEVDILGKYVQRLLSNGAITPIKS 281 >ref|NP_565482.1| lumazine-binding family protein [Arabidopsis thaliana] gi|13605593|gb|AAK32790.1|AF361622_1 At2g20690/F5H14.34 [Arabidopsis thaliana] gi|19548077|gb|AAL87403.1| At2g20690/F5H14.34 [Arabidopsis thaliana] gi|20197688|gb|AAD20926.2| putative riboflavin synthase alpha chain [Arabidopsis thaliana] gi|330251963|gb|AEC07057.1| lumazine-binding family protein [Arabidopsis thaliana] Length = 271 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 327 AYTQQKVVIALKKVGQKVNLEVDILGKYVERLLSRG 220 AYTQQ VVI KK+GQKVNLEVDI+GKYVERLL+ G Sbjct: 227 AYTQQNVVIPTKKIGQKVNLEVDIMGKYVERLLTSG 262