BLASTX nr result
ID: Mentha24_contig00033324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00033324 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22925.1| hypothetical protein MIMGU_mgv1a022556mg [Mimulus... 56 6e-06 >gb|EYU22925.1| hypothetical protein MIMGU_mgv1a022556mg [Mimulus guttatus] Length = 185 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/81 (39%), Positives = 46/81 (56%) Frame = -2 Query: 388 KYIGEVSLRVKGLFDYGLTCAKTLTFDVNGTTNGKLNILYSFGSVFLAQKRETLNLQQPQ 209 K++G V + +K LFD GL+ K ++ V GT GKLNI Y+F VF K +L + Sbjct: 102 KFVGHVDVPLKSLFDAGLSTEKIFSYTVAGTPYGKLNITYTFSEVFCVTK---ASLLKAA 158 Query: 208 VQGGLMAAGIVVKGVWELATG 146 +G +AA +V G W + TG Sbjct: 159 ARGAGIAA--LVHGAWFMLTG 177