BLASTX nr result
ID: Mentha24_contig00033162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00033162 (521 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF66436.1|AF249917_1 ADP-glucose pyrophosphorylase large sub... 75 7e-12 gb|EYU37810.1| hypothetical protein MIMGU_mgv1a004455mg [Mimulus... 63 5e-08 >gb|AAF66436.1|AF249917_1 ADP-glucose pyrophosphorylase large subunit [Perilla frutescens] Length = 527 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = +1 Query: 400 MDACCATLKSTSHLANVSKSVFCSEENGFWGEEIGGSRNN 519 MDACCATLKSTSHL+NVSKS FC E+NGFWGE+I GS NN Sbjct: 1 MDACCATLKSTSHLSNVSKSAFCGEKNGFWGEKIKGSLNN 40 >gb|EYU37810.1| hypothetical protein MIMGU_mgv1a004455mg [Mimulus guttatus] Length = 526 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/41 (68%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = +1 Query: 400 MDACCATLKSTSHLANVSKSVFCSEE-NGFWGEEIGGSRNN 519 MDACCATLK +HLAN+ K VFC+EE +GFWG++I GS NN Sbjct: 1 MDACCATLKPAAHLANLRKGVFCNEESSGFWGDKIRGSLNN 41