BLASTX nr result
ID: Mentha24_contig00032852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00032852 (450 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39775.1| hypothetical protein MIMGU_mgv1a001436mg [Mimulus... 72 1e-10 gb|EPS70792.1| hypothetical protein M569_03969, partial [Genlise... 60 2e-07 >gb|EYU39775.1| hypothetical protein MIMGU_mgv1a001436mg [Mimulus guttatus] Length = 820 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/51 (66%), Positives = 39/51 (76%), Gaps = 2/51 (3%) Frame = -2 Query: 152 MPSVGMRRTTRVFGARTLRSGRRLWTDPHEG--GKNVRGSHGENKFQELLD 6 MPSVGMRR TRVFG R LRSGRRLWT+P +G KN R SH ENK+ ++ D Sbjct: 1 MPSVGMRRNTRVFGTRVLRSGRRLWTEPSKGSNNKNARASHAENKWTDIPD 51 >gb|EPS70792.1| hypothetical protein M569_03969, partial [Genlisea aurea] Length = 698 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = -2 Query: 152 MPSVGMRRTTRVFGARTLRSGRRLWTDPHEGGKNVRGSHGENKFQE 15 MP+VGMRR TRVFG R LRSGR+L +P+ G K + +HGE KF + Sbjct: 1 MPAVGMRRKTRVFGTRILRSGRKLCMEPYAGSKYGKSAHGEGKFMD 46