BLASTX nr result
ID: Mentha24_contig00032780
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00032780 (512 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004244190.1| PREDICTED: probable ADP-ribosylation factor ... 57 2e-06 >ref|XP_004244190.1| PREDICTED: probable ADP-ribosylation factor GTPase-activating protein AGD5-like [Solanum lycopersicum] Length = 475 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/53 (50%), Positives = 33/53 (62%) Frame = -3 Query: 510 MMTDTQKAELQKYMQMGNMGPPRPIGNSYAPPTSGPYAMGNNAPSNGSMPSMP 352 +M K EL+KYMQ+GNMGP +GNS P S Y+MG N SNG +P P Sbjct: 391 IMPAAGKTELEKYMQVGNMGPAHVVGNSVPIPASSFYSMGQNTSSNGIVPPGP 443