BLASTX nr result
ID: Mentha24_contig00032696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00032696 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40340.1| hypothetical protein MIMGU_mgv1a002225mg [Mimulus... 65 1e-08 ref|XP_002526479.1| RNA binding protein, putative [Ricinus commu... 58 1e-06 >gb|EYU40340.1| hypothetical protein MIMGU_mgv1a002225mg [Mimulus guttatus] Length = 699 Score = 64.7 bits (156), Expect = 1e-08 Identities = 38/70 (54%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = +2 Query: 107 VPAYPKSG-LKRDYGHREELHSRSRAAATDYSSRATSXXXXXXXXXXXXXXXSGYSDLPR 283 VP+YPKSG KRDYG REELH RSR A DY+ RATS SGY DLPR Sbjct: 458 VPSYPKSGGFKRDYGQREELHPRSR-APVDYNPRATSDRRPPYREDYPHPRESGYPDLPR 516 Query: 284 GGASRSTGRR 313 SR RR Sbjct: 517 SVTSRPAPRR 526 >ref|XP_002526479.1| RNA binding protein, putative [Ricinus communis] gi|223534154|gb|EEF35870.1| RNA binding protein, putative [Ricinus communis] Length = 784 Score = 58.2 bits (139), Expect = 1e-06 Identities = 34/68 (50%), Positives = 39/68 (57%) Frame = +2 Query: 110 PAYPKSGLKRDYGHREELHSRSRAAATDYSSRATSXXXXXXXXXXXXXXXSGYSDLPRGG 289 P+YPKS LKRDYG REEL A DYSSR+ + SGYSD+PR G Sbjct: 552 PSYPKSSLKRDYGRREELPPPRSRAPVDYSSRSVA-ERRQSYRDDYSSRGSGYSDIPR-G 609 Query: 290 ASRSTGRR 313 SRS+ RR Sbjct: 610 TSRSSARR 617