BLASTX nr result
ID: Mentha24_contig00032530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00032530 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37854.1| hypothetical protein MIMGU_mgv1a000112mg [Mimulus... 63 5e-08 >gb|EYU37854.1| hypothetical protein MIMGU_mgv1a000112mg [Mimulus guttatus] Length = 1754 Score = 62.8 bits (151), Expect = 5e-08 Identities = 40/115 (34%), Positives = 58/115 (50%) Frame = +1 Query: 46 ASVSNNKWSGNETASLPSPTPKQSNTGWSGGGEASHLTVKVQSPSVNGALPSPTKFSPNL 225 + S KW+ N+ ++PSPTP Q HL +NGA+PSP + Sbjct: 1414 SKTSAEKWAVNDMTNMPSPTPTQRG----------HL--------INGAVPSPI-----I 1450 Query: 226 ATRTSNPTSVLNPVVQNTNFSPTPMSQHGISVNSAAPVHNQTTSMNEPNLAQMHG 390 T +S P SVL+ +++ FSPTP SQ G S SA H+ +T++ E + M G Sbjct: 1451 GTHSSTPASVLSAIIETATFSPTPNSQLGGS--SAVSRHSHSTTVTEQHEVPMQG 1503