BLASTX nr result
ID: Mentha24_contig00032483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00032483 (539 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU39256.1| hypothetical protein MIMGU_mgv1a026875mg [Mimulus... 58 2e-06 >gb|EYU39256.1| hypothetical protein MIMGU_mgv1a026875mg [Mimulus guttatus] Length = 541 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/47 (61%), Positives = 29/47 (61%) Frame = -1 Query: 143 MKEFNPTDPIGQNIIKQIXXXXXXXXXXXXXXXXVIAITYQPPDPWE 3 MKE NPTDPIGQNIIK I VIAITYQPPDPWE Sbjct: 1 MKELNPTDPIGQNIIKAISNVCFSVFVFSVLIFTVIAITYQPPDPWE 47