BLASTX nr result
ID: Mentha24_contig00032395
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00032395 (468 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631305.1| PREDICTED: LOW QUALITY PROTEIN: transcriptio... 59 9e-07 emb|CBI27416.3| unnamed protein product [Vitis vinifera] 59 9e-07 >ref|XP_003631305.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor bHLH49-like [Vitis vinifera] Length = 609 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 467 DELHNIVDMGFNSTPPRSSQDLNGSLPPGHVKAE 366 DELHN+V MGF++ P +SQDLNGSLPPGH+KAE Sbjct: 575 DELHNVVQMGFSTGAPLNSQDLNGSLPPGHMKAE 608 >emb|CBI27416.3| unnamed protein product [Vitis vinifera] Length = 496 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -2 Query: 467 DELHNIVDMGFNSTPPRSSQDLNGSLPPGHVKAE 366 DELHN+V MGF++ P +SQDLNGSLPPGH+KAE Sbjct: 462 DELHNVVQMGFSTGAPLNSQDLNGSLPPGHMKAE 495