BLASTX nr result
ID: Mentha24_contig00031272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00031272 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI21545.3| unnamed protein product [Vitis vinifera] 59 9e-07 ref|XP_006381970.1| hypothetical protein POPTR_0006s22590g, part... 56 5e-06 >emb|CBI21545.3| unnamed protein product [Vitis vinifera] Length = 80 Score = 58.5 bits (140), Expect = 9e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +3 Query: 162 SDIQGRRKNSISSQAWRRRKLLGGHCECFEKQALRFSIIAIE 287 SDIQGR +S +SQAW+RRKLLGG+CECFEKQA II IE Sbjct: 10 SDIQGRI-SSTNSQAWQRRKLLGGYCECFEKQAFGVVIIDIE 50 >ref|XP_006381970.1| hypothetical protein POPTR_0006s22590g, partial [Populus trichocarpa] gi|550336872|gb|ERP59767.1| hypothetical protein POPTR_0006s22590g, partial [Populus trichocarpa] Length = 73 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 183 KNSISSQAWRRRKLLGGHCECFEKQALRFSIIAIE 287 K+S+ +QAWRRRK LGGHCECFEKQA F II ++ Sbjct: 2 KSSMRTQAWRRRKHLGGHCECFEKQAFEFIIIDLQ 36