BLASTX nr result
ID: Mentha24_contig00031200
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00031200 (548 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38793.1| hypothetical protein MIMGU_mgv1a001839mg [Mimulus... 59 1e-06 >gb|EYU38793.1| hypothetical protein MIMGU_mgv1a001839mg [Mimulus guttatus] Length = 751 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +2 Query: 2 KHPSQPTKSRTDEMQELFKDDMSEKRQKRTLKAG 103 KHPSQ TKSRT+EMQELF+ DMSEK+QKRTL G Sbjct: 702 KHPSQATKSRTEEMQELFQGDMSEKKQKRTLAGG 735