BLASTX nr result
ID: Mentha24_contig00031135
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00031135 (328 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007040554.1| Phosphoinositide 4-kinase gamma 4, gamma 4,u... 56 5e-06 ref|XP_004298914.1| PREDICTED: uncharacterized protein LOC101293... 56 5e-06 >ref|XP_007040554.1| Phosphoinositide 4-kinase gamma 4, gamma 4,ubdk gamma 4,pi4k gamma 4 [Theobroma cacao] gi|508777799|gb|EOY25055.1| Phosphoinositide 4-kinase gamma 4, gamma 4,ubdk gamma 4,pi4k gamma 4 [Theobroma cacao] Length = 589 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/36 (72%), Positives = 34/36 (94%) Frame = -3 Query: 326 IEEIVEDAEDAMLPGMSEAAFLETVSEVMDSTLNKL 219 IE+IV +A+D++LPGMSEAAF+ETVS+VMDS L+KL Sbjct: 552 IEQIVREAQDSLLPGMSEAAFIETVSQVMDSWLDKL 587 >ref|XP_004298914.1| PREDICTED: uncharacterized protein LOC101293093 [Fragaria vesca subsp. vesca] Length = 582 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 326 IEEIVEDAEDAMLPGMSEAAFLETVSEVMDSTLNKL 219 IEEIV +AED++LPGMSEA FLE +SE+MDS L+KL Sbjct: 545 IEEIVTEAEDSLLPGMSEATFLEAISEIMDSRLDKL 580