BLASTX nr result
ID: Mentha24_contig00030863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha24_contig00030863 (452 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19896.1| hypothetical protein MIMGU_mgv1a002583mg [Mimulus... 73 4e-11 ref|XP_007030387.1| Ankyrin repeat family protein isoform 1 [The... 61 1e-07 ref|XP_006649154.1| PREDICTED: ankyrin repeat domain-containing ... 61 2e-07 dbj|BAD19146.1| ankyrin repeat protein-like [Oryza sativa Japoni... 61 2e-07 gb|EAZ25027.1| hypothetical protein OsJ_08814 [Oryza sativa Japo... 61 2e-07 gb|EAY87957.1| hypothetical protein OsI_09382 [Oryza sativa Indi... 61 2e-07 ref|XP_007147211.1| hypothetical protein PHAVU_006G105000g [Phas... 60 2e-07 gb|AFK46341.1| unknown [Lotus japonicus] 60 2e-07 gb|EPS67902.1| hypothetical protein M569_06870, partial [Genlise... 60 3e-07 ref|XP_003536135.1| PREDICTED: ankyrin repeat domain-containing ... 60 3e-07 gb|EXB93157.1| Ankyrin repeat domain-containing protein 13B [Mor... 60 4e-07 ref|XP_004152818.1| PREDICTED: ankyrin repeat domain-containing ... 60 4e-07 ref|XP_007144021.1| hypothetical protein PHAVU_007G122500g [Phas... 59 5e-07 ref|XP_002266715.2| PREDICTED: ankyrin repeat domain-containing ... 59 5e-07 ref|XP_002521987.1| protein binding protein, putative [Ricinus c... 59 7e-07 ref|XP_006605266.1| PREDICTED: ankyrin repeat domain-containing ... 59 9e-07 ref|XP_003521769.1| PREDICTED: ankyrin repeat domain-containing ... 59 9e-07 ref|XP_006470925.1| PREDICTED: ankyrin repeat domain-containing ... 58 1e-06 ref|XP_006442646.1| hypothetical protein CICLE_v10019229mg [Citr... 58 1e-06 ref|XP_002325341.2| hypothetical protein POPTR_0019s03660g [Popu... 57 2e-06 >gb|EYU19896.1| hypothetical protein MIMGU_mgv1a002583mg [Mimulus guttatus] Length = 656 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 MRGSRGAQSS DSEGRSFRDEVDPFNIP+DY WVDANE Sbjct: 588 MRGSRGAQSS-DSEGRSFRDEVDPFNIPADYTWVDANE 624 >ref|XP_007030387.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] gi|590641993|ref|XP_007030388.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] gi|508718992|gb|EOY10889.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] gi|508718993|gb|EOY10890.1| Ankyrin repeat family protein isoform 1 [Theobroma cacao] Length = 658 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 MRGSRG QSS DS+ ++DEVDPF+IPSDY WVDANE Sbjct: 586 MRGSRGGQSS-DSDSHRYKDEVDPFHIPSDYTWVDANE 622 >ref|XP_006649154.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like, partial [Oryza brachyantha] Length = 559 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 +RG RGAQSS + R+++DEVDPF IPSDY WVDANE Sbjct: 482 VRGGRGAQSSDSGDSRNWKDEVDPFQIPSDYTWVDANE 519 >dbj|BAD19146.1| ankyrin repeat protein-like [Oryza sativa Japonica Group] Length = 633 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 +RG RGAQSS + R+++DEVDPF IPSDY WVDANE Sbjct: 557 VRGGRGAQSSDSGDSRNWKDEVDPFQIPSDYTWVDANE 594 >gb|EAZ25027.1| hypothetical protein OsJ_08814 [Oryza sativa Japonica Group] Length = 544 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 +RG RGAQSS + R+++DEVDPF IPSDY WVDANE Sbjct: 470 VRGGRGAQSSDSGDSRNWKDEVDPFQIPSDYTWVDANE 507 >gb|EAY87957.1| hypothetical protein OsI_09382 [Oryza sativa Indica Group] Length = 634 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 +RG RGAQSS + R+++DEVDPF IPSDY WVDANE Sbjct: 557 VRGGRGAQSSDSGDSRNWKDEVDPFQIPSDYTWVDANE 594 >ref|XP_007147211.1| hypothetical protein PHAVU_006G105000g [Phaseolus vulgaris] gi|561020434|gb|ESW19205.1| hypothetical protein PHAVU_006G105000g [Phaseolus vulgaris] Length = 687 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 M+GSRG QSS DS+ ++DEVDPFNIP+DY WVDANE Sbjct: 613 MKGSRGGQSS-DSDSHRYKDEVDPFNIPADYKWVDANE 649 >gb|AFK46341.1| unknown [Lotus japonicus] Length = 254 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 ++GSRG QSS DS+G ++DEVDPF+IPSDY WVDANE Sbjct: 180 VKGSRGTQSS-DSDGHRYKDEVDPFSIPSDYKWVDANE 216 >gb|EPS67902.1| hypothetical protein M569_06870, partial [Genlisea aurea] Length = 652 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 MRGS QSS DSE RSF+DEVDPF+IPSDY+W+D NE Sbjct: 578 MRGSHVGQSS-DSENRSFQDEVDPFHIPSDYSWIDGNE 614 >ref|XP_003536135.1| PREDICTED: ankyrin repeat domain-containing protein 13C-B-like [Glycine max] Length = 725 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 M+GSRG QSS DS+ F+DE+DPF+IPSDY WVDANE Sbjct: 652 MKGSRGTQSS-DSDSHKFKDEMDPFSIPSDYKWVDANE 688 >gb|EXB93157.1| Ankyrin repeat domain-containing protein 13B [Morus notabilis] Length = 662 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 MRGSRG QSS DS+ F+DEVDPF+IP DY W+DANE Sbjct: 587 MRGSRGGQSS-DSDSHRFKDEVDPFHIPLDYTWIDANE 623 >ref|XP_004152818.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Cucumis sativus] gi|449477722|ref|XP_004155104.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Cucumis sativus] Length = 658 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 MRGSRG QSS DS+ ++DEVDPF+IPS+Y WVDANE Sbjct: 587 MRGSRGGQSS-DSDSNRYKDEVDPFHIPSEYTWVDANE 623 >ref|XP_007144021.1| hypothetical protein PHAVU_007G122500g [Phaseolus vulgaris] gi|561017211|gb|ESW16015.1| hypothetical protein PHAVU_007G122500g [Phaseolus vulgaris] Length = 639 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 M+GSRG QS DS+ +RDE DPFNIPSDY WVDANE Sbjct: 566 MKGSRGTQSG-DSDSHRYRDEFDPFNIPSDYKWVDANE 602 >ref|XP_002266715.2| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Vitis vinifera] Length = 660 Score = 59.3 bits (142), Expect = 5e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 MRGSRG QSS D E ++D++DPF+IPSDY WVDANE Sbjct: 587 MRGSRGGQSS-DGESHRYKDDIDPFHIPSDYTWVDANE 623 >ref|XP_002521987.1| protein binding protein, putative [Ricinus communis] gi|223538791|gb|EEF40391.1| protein binding protein, putative [Ricinus communis] Length = 661 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 MRGS G QSS DS+ ++DE+DPF+IPSDY WVDANE Sbjct: 588 MRGSNGGQSS-DSDSHRYKDEIDPFHIPSDYTWVDANE 624 >ref|XP_006605266.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Glycine max] Length = 622 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 M+GSRG QSS DS+ ++DEVDPF+IP+DY WVDANE Sbjct: 548 MKGSRGGQSS-DSDSHRYKDEVDPFSIPADYKWVDANE 584 >ref|XP_003521769.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like isoform X1 [Glycine max] gi|571447185|ref|XP_006577310.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like isoform X2 [Glycine max] Length = 689 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 M+GSRG QSS DS+ ++DEVDPF+IP+DY WVDANE Sbjct: 614 MKGSRGGQSS-DSDSHRYKDEVDPFSIPADYKWVDANE 650 >ref|XP_006470925.1| PREDICTED: ankyrin repeat domain-containing protein 13B-like [Citrus sinensis] Length = 652 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 MRGSRG QSS DS+ ++DE+DPF IP+DY WVDANE Sbjct: 581 MRGSRGGQSS-DSDSHRYKDEIDPFLIPADYTWVDANE 617 >ref|XP_006442646.1| hypothetical protein CICLE_v10019229mg [Citrus clementina] gi|557544908|gb|ESR55886.1| hypothetical protein CICLE_v10019229mg [Citrus clementina] Length = 651 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDANE 286 MRGSRG QSS DS+ ++DE+DPF IP+DY WVDANE Sbjct: 581 MRGSRGGQSS-DSDSHRYKDEIDPFLIPADYTWVDANE 617 >ref|XP_002325341.2| hypothetical protein POPTR_0019s03660g [Populus trichocarpa] gi|550316704|gb|EEE99722.2| hypothetical protein POPTR_0019s03660g [Populus trichocarpa] Length = 664 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -3 Query: 399 MRGSRGAQSSCDSEGRSFRDEVDPFNIPSDYAWVDAN 289 MRGSRG QSS DS+ ++DE+DPF IPSDY WVDAN Sbjct: 586 MRGSRGGQSS-DSDSHRYKDEIDPFLIPSDYTWVDAN 621